Overview

  • Product name
  • Description
    Rabbit polyclonal to DIRC2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human DIRC2 aa 136-187.
    Sequence:

    IPISDLILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAI AS


    Database link: Q96SL1

  • Positive control
    • ICC/IF: RH-30 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Electrogenic metabolite transporter.
  • Tissue specificity
    Ubiquitous. Expressed in proximal tubular cells of the kidney.
  • Involvement in disease
    Note=A chromosomal aberration involving DIRC2 has been found in a family with renal carcinoma. Translocation t(2;3)(q35;q21).
  • Sequence similarities
    Belongs to the major facilitator superfamily.
  • Post-translational
    modifications
    Cleaved in lysosomes by cathepsin L between Leu-214 and Ala-261, generating a N-glycosylated N-terminal and a non-glycosylated C-terminal fragment.
  • Cellular localization
    Lysosome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • DIRC 2 antibody
    • dirc2 antibody
    • DIRC2_HUMAN antibody
    • Disrupted in renal cancer protein 2 antibody
    • Disrupted in renal carcinoma 2 antibody
    • Disrupted in renal carcinoma protein 2 antibody
    • FLJ14784 antibody
    • NP_116228 antibody
    • RCC 4 antibody
    • RCC4 antibody
    • Renal cell carcinoma 4 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized RH-30 cells stained for DIRC2 (green) using ab222044 at 4 µg/ml in ICC/IF.

References

ab222044 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222044.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up