Overview

  • Product nameAnti-DIRC2 antibody
    See all DIRC2 primary antibodies
  • Description
    Rabbit polyclonal to DIRC2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 216-265 of Human DIRC2 (DIRC2

    AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ

    )

  • Positive control
    • MCF7 Cell Lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab85188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionElectrogenic metabolite transporter.
  • Tissue specificityUbiquitous. Expressed in proximal tubular cells of the kidney.
  • Involvement in diseaseNote=A chromosomal aberration involving DIRC2 has been found in a family with renal carcinoma. Translocation t(2;3)(q35;q21).
  • Sequence similaritiesBelongs to the major facilitator superfamily.
  • Post-translational
    modifications
    Cleaved in lysosomes by cathepsin L between Leu-214 and Ala-261, generating a N-glycosylated N-terminal and a non-glycosylated C-terminal fragment.
  • Cellular localizationLysosome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • DIRC 2 antibody
    • dirc2 antibody
    • DIRC2_HUMAN antibody
    • Disrupted in renal cancer protein 2 antibody
    • Disrupted in renal carcinoma 2 antibody
    • Disrupted in renal carcinoma protein 2 antibody
    • FLJ14784 antibody
    • NP_116228 antibody
    • RCC 4 antibody
    • RCC4 antibody
    • Renal cell carcinoma 4 antibody
    see all

Anti-DIRC2 antibody images

  • Anti-DIRC2 antibody (ab85188) at 1 µg/ml + MCF7 Cell Lysate at 10 µg

    Predicted band size : 52 kDa

References for Anti-DIRC2 antibody (ab85188)

ab85188 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"