Overview

  • Product name
  • Description
    Rabbit polyclonal to DIS3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human DIS3 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    WVAPSSVVLHDEGQNEEDVEKEEETERMLK


    Database link: Q9Y2L1

  • Positive control
    • Mouse bladder lysate; Human skin tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab179933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 109 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    Putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as anti-sense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. DIS3 has both 3'-5' exonuclease and endonuclease activities.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the RNR ribonuclease family.
    Contains 1 PINc domain.
  • Cellular localization
    Cytoplasm. Nucleus > nucleolus. Nucleus > nucleoplasm. Nucleus. Predominantly located in the nucleus. According to PubMed:12429849, found in the nucleolus and according to PubMed:20531386, excluded from nucleolus supporting the existence of a nucleolar RNA exosome complex devoid of DIS3.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2810028N01Rik antibody
    • bA555G22 antibody
    • Dis3 antibody
    • DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease antibody
    • DIS3 mitotic control homolog (S. cerevisiae) antibody
    • DIS3 mitotic control homolog antibody
    • DIS3 mitotic control, S. cerevisiae, homolog of antibody
    • dis3p antibody
    • EXOSC11 antibody
    • Exosome complex exonuclease RRP44 antibody
    • exosome component 11 antibody
    • KIAA1008 antibody
    • Mitotic control protein dis3 homolog antibody
    • Protein DIS3 homolog antibody
    • Ribosomal RNA processing protein 44 antibody
    • Ribosomal RNA processing protein 44, S. cerevisiae, homolog of antibody
    • Ribosomal RNA-processing protein 44 antibody
    • RP11-342J4.3 antibody
    • RRP44 antibody
    • RRP44_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human skin tissue labelling DIS3 with ab179933 at 5µg/ml.

  • Anti-DIS3 antibody (ab179933) at 1/1000 dilution + Mouse bladder lysate at 15 µg

    Predicted band size: 109 kDa

References

ab179933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up