Overview

  • Product name
  • Description
    Mouse polyclonal to DLL1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Full length protein corresponding to Human DLL1 aa 1-723.
    Sequence:

    MGSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAG PPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGA DSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQ RHLTVGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFG HFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQ GRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKN GATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSY SCTCPPGFYGKICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGF NCEKKIDYCSSSPCSNGAKCVDLGDAYLCRCQAGFSGRHCDDNVDDCASS PCANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCEHAPCHNGATCHERG HRYVCECARGYGGPNCQFLLPELPPGPAVVDLTEKLEGQGGPFPWVAVCA GVILVLMLLLGCAAVVVCVRLRLQKHRPPADPCRGETETMNNLANCQREK DISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGD DTAVRDAHSKRDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSK DTKYQSVYVISEEKDECVIATEV


    Database link: NP_005609.3

  • Positive control
    • DLL1-transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 78 kDa.

Target

  • Function
    Acts as a ligand for Notch receptors. Blocks the differentiation of progenitor cells into the B-cell lineage while promoting the emergence of a population of cells with the characteristics of a T-cell/NK-cell precursor.
  • Tissue specificity
    Expressed in heart and pancreas, with lower expression in brain and muscle and almost no expression in placenta, lung, liver and kidney.
  • Sequence similarities
    Contains 1 DSL domain.
    Contains 8 EGF-like domains.
  • Post-translational
    modifications
    Ubiquitinated by MIB (MIB1 or MIB2), leading to its endocytosis and subsequent degradation.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Delta (Drosophila) like 1 antibody
    • Delta antibody
    • Delta like 1 (Drosophila) antibody
    • Delta like 1 antibody
    • Delta like 1 protein antibody
    • Delta like protein 1 antibody
    • Delta like protein 1 precursor antibody
    • Delta, Drosophila, homolog of 1 antibody
    • Delta-like protein 1 antibody
    • Delta1 antibody
    • DL1 antibody
    • DLL 1 antibody
    • DLL1 antibody
    • DLL1_HUMAN antibody
    • Drosophila Delta homolog 1 antibody
    • H-Delta-1 antibody
    • OTTHUMP00000017690 antibody
    see all

Images

  • All lanes : Anti-DLL1 antibody (ab172496) at 1 µg/ml

    Lane 1 : DLL1-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H+L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 78 kDa

References

ab172496 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172496.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up