Overview

  • Product name
    Anti-DLL3 antibody - C-terminal
    See all DLL3 primary antibodies
  • Description
    Rabbit polyclonal to DLL3 - C-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Cat, Pig
  • Immunogen

    Synthetic peptide within Human DLL3 aa 451-500 (C terminal). The exact sequence is proprietary. Isoform 2.
    Sequence:

    LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL


    Database link: Q9NYJ7-2

  • Positive control
    • HeLa whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab182092 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 61 kDa.

Target

  • Function
    Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm.
  • Involvement in disease
    Spondylocostal dysostosis 1
  • Sequence similarities
    Contains 1 DSL domain.
    Contains 6 EGF-like domains.
  • Domain
    The DSL domain is required for binding to the Notch receptor.
  • Post-translational
    modifications
    Ubiquitinated by MIB (MIB1 or MIB2), leading to its endocytosis and subsequent degradation.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Delta Drosophila like 3 antibody
    • Delta like 3 Drosophila antibody
    • Delta like 3 homolog Drosophila antibody
    • Delta like 3 protein antibody
    • Delta like protein 3 precursor antibody
    • Delta-like protein 3 antibody
    • Delta3 antibody
    • Dll3 antibody
    • DLL3_HUMAN antibody
    • Drosophila Delta homolog 3 antibody
    • SCDO1 antibody
    • SCOD1 antibody
    • Spondylocostal dysostosis autosomal recessive antibody
    see all

Images

  • Anti-DLL3 antibody - C-terminal (ab182092) at 1 µg/ml + HeLa whole cell lysate at 10 µg

    Predicted band size : 61 kDa

References

ab182092 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182092.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up