Overview

  • Product nameAnti-Dlp antibody
  • Description
    Mouse polyclonal to Dlp
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Drosophila melanogaster
  • Immunogen

    Fusion protein:

    GIDAIEIPQKPSNERVLRYCESPSVGTCCTYNMETRMAMQSRQQLEGHTK DQISRM

    , corresponding to amino acids 91/146 of Fruit fly (Drosophila melanogaster) Dlp

  • General notes

    Produced from outbred CD1 mice

     

    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferConstituents: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notesThis antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab22009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 85 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • RelevanceDlp (Dally like) protein is required for proper axon guidance and visual-system function. It acts as a gatekeeper, ensuring the sharing of Wingless among cells along the dorsoventral axis. Dlp regulates wg morphogen spatial distribution and signaling. It also has a role in Hedgehog signalling in Drosphila embryonic epidermis.
  • Cellular localizationCell Membrane
  • Database links
    • Alternative names
      • D glypican B antibody
      • Dally like antibody
      • Dally like protein antibody
      • dlp antibody

    Anti-Dlp antibody images

    • All lanes : Anti-Dlp antibody (ab22009) at 1/1000 dilution

      Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
      Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

      Secondary
      Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

      Predicted band size : 85 kDa

    References for Anti-Dlp antibody (ab22009)

    ab22009 has not yet been referenced specifically in any publications.

    Product Wall

    Application Immunocytochemistry/ Immunofluorescence
    Blocking step Serum as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: 22°C
    Sample Fruit fly (Drosophila melanogaster) Cell (Drosophila S2 R+ cells)
    Specification Drosophila S2 R+ cells
    Permeabilization No
    Fixative Paraformaldehyde
    Username

    Abcam user community

    Verified customer

    Submitted Oct 25 2013

    Application Immunocytochemistry/ Immunofluorescence
    Blocking step Serum as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: 22°C
    Sample Fruit fly (Drosophila melanogaster) Cell (Drosophila S2 R+ cells)
    Specification Drosophila S2 R+ cells
    Permeabilization No
    Fixative Paraformaldehyde
    Username

    Abcam user community

    Verified customer

    Submitted Oct 24 2013

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"