Anti-DMC1 antibody [2H12/4] (HRP) (ab187794)

Overview

  • Product name
    Anti-DMC1 antibody [2H12/4] (HRP)
    See all DMC1 primary antibodies
  • Description
    Mouse monoclonal [2H12/4] to DMC1 (HRP)
  • Conjugation
    HRP
  • Tested applications
    Suitable for: IP, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Cow, Human
  • Immunogen

    Recombinant full length protein corresponding to Human DMC1 aa 1-340.
    Sequence:

    MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKG IQMTTRRALC NVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMV FHITTGSQEFDKLLGGGIESMA ITEAFGEFRTGKTQLSHTLCVTAQLP GAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVD HDAVLDNVLYARAY TSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELA ER QQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHI LAHASTTR ISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE


    Database link: Q14565

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C.
  • Storage buffer
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Purification notes
    Purified from tissue culture supernatant.
  • Clonality
    Monoclonal
  • Clone number
    2H12/4
  • Myeloma
    Sp2/0-Ag14
  • Isotype
    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187794 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 38 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    May participate in meiotic recombination, specifically in homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks.
  • Sequence similarities
    Belongs to the RecA family. DMC1 subfamily.
    Contains 1 HhH domain.
  • Cellular localization
    Nucleus. Chromosome.
  • Information by UniProt
  • Database links
  • Alternative names
    • Disrupted meiotic cDNA 1 homolog antibody
    • Disrupted meiotic cDNA 1, yeast, homolog of antibody
    • dJ199H16.1 antibody
    • DMC 1 antibody
    • DMC1 antibody
    • DMC1 dosage suppressor of mck1 homolog antibody
    • DMC1 dosage suppressor of mck1 homolog meiosis specific homologous recombination (yeast) antibody
    • DMC1 homologue antibody
    • DMC1_HUMAN antibody
    • DMC1H antibody
    • DNA meiotic recombinase 1 antibody
    • HsLim15 antibody
    • LIM15 antibody
    • Meiotic recombination protein DMC1/LIM15 homolog antibody
    • MGC150472 antibody
    • MGC150473 antibody
    see all

References

ab187794 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187794.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up