Overview

  • Product nameAnti-Dmrtc2 antibody
    See all Dmrtc2 primary antibodies
  • Description
    Rabbit polyclonal to Dmrtc2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 72-121 of Human Dmrtc2;

    VLILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQPQ

    (NP_001035373)

  • Positive control
    • Jurkat cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab85597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 39 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in sexual development.
  • Tissue specificityExpressed in testis and pancreas.
  • Sequence similaritiesBelongs to the DMRT family.
    Contains 1 DM DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 4933432E21Rik antibody
    • DMRT like family C2 antibody
    • DMRT-like family C2 antibody
    • Dmrt7 antibody
    • Dmrtc2 antibody
    • Dmrtc2 doublesex and mab-3 related transcription factor like family C2 antibody
    • DMRTD_HUMAN antibody
    • Doublesex and mab 3 related transcription factor 7 antibody
    • Doublesex and mab 3 related transcription factor C2 antibody
    • Doublesex and mab-3 related transcription factor like family C2 antibody
    • Doublesex- and mab-3-related transcription factor 7 antibody
    • Doublesex- and mab-3-related transcription factor C2 antibody
    see all

Anti-Dmrtc2 antibody images

  • Anti-Dmrtc2 antibody (ab85597) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 39 kDa
    Observed band size : 39 kDa

References for Anti-Dmrtc2 antibody (ab85597)

ab85597 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"