
  • Product name
  • Description
    Rabbit polyclonal to DMTF1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal aa 216-265 (RMYDDRNHVGKYTPEEIEKLKELRIKHGNDWATIGAALGRSASSVKDRC R) of human DMTF1 (NP_066968).

  • Positive control
    • PANC1 cell lysate



Our Abpromise guarantee covers the use of ab87782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 84 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Transcriptional activator which activates the CDKN2A/ARF locus in response to Ras-Raf signaling, thereby promoting p53/TP53-dependent growth arrest (By similarity). Binds to the consensus sequence 5'-CCCG[GT]ATGT-3' (By similarity). Isoform 1 may cooperate with MYB to activate transcription of the ANPEP gene. Isoform 2 may antagonize transcriptional activation by isoform 1.
  • Tissue specificity
    Expressed at relatively low levels in colonic mucosa, ovary, peripheral leukocytes, prostate and small intestine, and at higher levels in spleen, testis and thymus. Expressed in multiple regions of the brain and CNS including amygdala, caudate, corpus callosum, hippocampus, substantia nigra and subthalamic nucleus. Isoform 1 is the predominant isoform in monocytes, macrophages and neutrophils, isoform 2 is most strongly expressed in peripheral blood leukocytes and quiescent CD34 positive cells, and isoform 3 is expressed at low levels in all hematopoietic cell types. Expression is frequently reduced in non-small-cell lung carcinomas (NSCLC) due to hemizygous gene deletion, strongly suggesting that this locus is haploinsufficient for tumor suppression. Loss of this locus frequently occurs in tumors which retain wild-type CDKN2A/ARF and p53/TP53 loci. Hemizygous gene deletion has also been observed in leukemic blasts from patients with abnormalities of the long arm of chromosome 7.
  • Sequence similarities
    Belongs to the DMTF1 family.
    Contains 1 HTH myb-type DNA-binding domain.
    Contains 2 Myb-like domains.
  • Developmental stage
    Isoform 2 expression is down-regulated during myeloid differentiation, while the expression of isoform 1 and isoform 3 remain constant.
  • Post-translational
    Phosphorylated by the cyclin-D2/CDK4, cyclin-D3/CDK4 and cyclin-D2/CDK6 complexes and to a lesser extent by the cyclin-D1/CDK4 complex.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • Cyclin D binding Myb like protein antibody
    • Cyclin D binding Myb like transcription factor 1 antibody
    • cyclin D binding myb like transcription factor 1D interacting myb like protein antibody
    • Cyclin D interacting Myb like protein 1 antibody
    • Cyclin-D-binding Myb-like transcription factor 1 antibody
    • Cyclin-D-interacting Myb-like protein 1 antibody
    • D interacting myb like protein antibody
    • DMP1 antibody
    • DMTF antibody
    • dmtf1 antibody
    • DMTF1_HUMAN antibody
    • hDMP1 antibody
    • hDMTF1 antibody
    • mDmp1 antibody
    see all

Anti-DMTF1 antibody images

  • Anti-DMTF1 antibody (ab87782) at 1 µg/ml + PANC1 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1: 50,000

    Predicted band size : 84 kDa
    Observed band size : 84 kDa
    Additional bands at : 31 kDa. We are unsure as to the identity of these extra bands.

References for Anti-DMTF1 antibody (ab87782)

ab87782 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87782.
Please use the links above to contact us or submit feedback about this product.


Sign up