Overview

  • Product name
    Anti-DNA ligase antibody (HRP)
    See all DNA ligase primary antibodies
  • Description
    Rabbit polyclonal to DNA ligase (HRP)
  • Host species
    Rabbit
  • Conjugation
    HRP
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli DNA ligase aa 1-671.
    Sequence:

    MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHP ELITPDSPTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQD RLKNNEKVTWCCELKLDGLAVSILYENGVLVSAATRGDGTTGEDITSNVR TIRAIPLKLHGENIPARLEVRGEVFLPQAGFEKINEDARRTGGKVFANPR NAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGELPDTHLGRLLQFKKWG LPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLAQQEQL GFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAG VLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTR EVVFPTHCPVCGSDVERVEGEAVARCTGGLICGAQRKESLKHFVSRRAMD VDGMGDKIIDQLVEKEYVHTPADLFKLTAGKLTGLERMGPKSAQNVVNAL EKAKETTFARFLYALGIREVGEATAAGLAAYFGTLEALEAASIEELQKVP DVGIVVASHVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAG KTVVLTGSLSQMSRDDAKARLVELGAKVAGSVSKKTDLVIAGEAAGSKLA KAQELGIEVIDEAEMLRLLGS


    Database link: P15042

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C.
  • Storage buffer
    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/300. Predicted molecular weight: 74 kDa.

Target

  • Relevance
    DNA ligase that catalyzes the formation of phosphodiester linkages between 5'-phosphoryl and 3'-hydroxyl groups in double-stranded DNA using NAD as a coenzyme and as the energy source for the reaction. It is essential for DNA replication and repair of damaged DNA.
  • Database links
    • Alternative names
      • DNA ligase NAD(+) dependent antibody
      • ligA antibody
      • Polydeoxyribonucleotide synthase [NAD(+)] antibody

    References

    ab193513 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193513.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up