Anti-DNA Polymerase epsilon antibody (ab83442)

Overview

  • Product nameAnti-DNA Polymerase epsilon antibody
    See all DNA Polymerase epsilon primary antibodies
  • Description
    Rabbit polyclonal to DNA Polymerase epsilon
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 1-50 (AERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATS C) of Human POLE3 (NP_059139).

  • Positive control
    • Human fetal lung lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab83442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 16 kDa.Can be blocked with DNA Polymerase epsilon peptide (ab135296). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titer in peptide based assay is 1/1562500.

Target

  • FunctionForms a complex with DNA polymerase epsilon subunit CHRAC1 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome-remodeling activity of ISWI/SNF2H and ACF1.
  • Tissue specificityExpressed in all tissues tested, including, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Arsenic transactivated protein antibody
    • Arsenic-transactivated protein antibody
    • ASTP antibody
    • CHARAC 17 antibody
    • CHARAC17 antibody
    • CHRAC 17 antibody
    • CHRAC-17 antibody
    • CHRAC17 antibody
    • Chromatin Accessibility Complex 17 antibody
    • Chromatin accessibility complex 17 kDa protein antibody
    • DNA Polymerase Epsilon p17 Subunit antibody
    • DNA polymerase epsilon subunit 3 antibody
    • DNA polymerase epsilon subunit p17 antibody
    • DNA polymerase II subunit 3 antibody
    • DPOE3_HUMAN antibody
    • Histone fold protein CHRAC17 antibody
    • HuCHRAC 17 antibody
    • HuCHRAC17 antibody
    • p17 antibody
    • p17 subunit antibody
    • POL E3 antibody
    • POLE 3 antibody
    • POLE3 antibody
    • Polymerase (DNA directed) epsilon 3 antibody
    • YBL 1 antibody
    • YBL1 antibody
    see all

Anti-DNA Polymerase epsilon antibody images

  • Anti-DNA Polymerase epsilon antibody (ab83442) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal lung lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG diluted in 1/50000 - 1/100000 as secondary antibody.

    Predicted band size : 16 kDa

References for Anti-DNA Polymerase epsilon antibody (ab83442)

ab83442 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting Abcam.
We have now been able to add the peptide used to generate ab83442 to the catalogue.
It has been added as: DNA Polymerase epsilon peptide (ab135296)
If there is anything else I can help you with, please let m...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"