Anti-DNA polymerase eta antibody (ab186677)

Overview

  • Product name
    Anti-DNA polymerase eta antibody
  • Description
    Rabbit polyclonal to DNA polymerase eta
  • Tested applications
    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DNA polymerase eta aa 417-529.
    Sequence:

    PPLTMLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGS GPAVTATKKATTSLESFFQKAAERQKVKEASLSSLTAPTQAPMSNSPSKP SLPFQTSQSTGTE


    Database link: Q9Y253

  • Positive control
    • U251MG cells; Human stomach tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Plays an important role in the repair of UV-induced pyrimidine dimers. Depending on the context, it inserts the correct base, but causes frequent base transitions and transversions. May play a role in hypermutation at immunoglobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have lyase activity. Targets POLI to replication foci.
  • Involvement in disease
    Defects in POLH are the cause of xeroderma pigmentosum variant type (XPV) [MIM:278750]; also designated as XP-V. Xeroderma pigmentosum (XP) is an autosomal recessive disease due to deficient nucleotide excision repair. It is characterized by hypersensitivity of the skin to sunlight, followed by high incidence of skin cancer and frequent neurologic abnormalities. XPV shows normal nucleotide excision repair, but an exaggerated delay in recovery of replicative DNA synthesis. Most XPV patients do not develop clinical symptoms and skin neoplasias until a later age. Clinical manifestations are limited to photo-induced deterioration of the skin and eyes.
  • Sequence similarities
    Belongs to the DNA polymerase type-Y family.
    Contains 1 umuC domain.
  • Domain
    The catalytic core consists of fingers, palm and thumb subdomains, but the fingers and thumb subdomains are much smaller than in high-fidelity polymerases; residues from five sequence motifs of the Y-family cluster around an active site cleft that can accommodate DNA and nucleotide substrates with relaxed geometric constraints, with consequently higher rates of misincorporation and low processivity.
  • Cellular localization
    Nucleus. Accumulates at replication forks after DNA damage.
  • Information by UniProt
  • Database links
  • Alternative names
    • DNA polymerase eta antibody
    • FLJ16395 antibody
    • FLJ21978 antibody
    • Polh antibody
    • POLH_HUMAN antibody
    • polymerase DNA directed eta antibody
    • RAD30 antibody
    • RAD30 homolog A antibody
    • RAD30A antibody
    • Xeroderma pigmentosum variant type protein antibody
    • XP V antibody
    • XPV antibody
    see all

Images

  • Immunofluorescent analysis of U251MG cells (PFA-fixed/Triton X-100 permeabilized) labeling DNA polymerase eta with ab186677 at 4μg/ml.

  • Immunohistochemical analysis of Paraffin-embedded Human stomach tissue labeling DNA polymerase eta with ab186677 at 1/50 dilution.

References

ab186677 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186677.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up