Overview

  • Product nameAnti-DNA Polymerase Kappa/POLK antibody
    See all DNA Polymerase Kappa/POLK primary antibodies
  • Description
    Mouse monoclonal to DNA Polymerase Kappa/POLK
  • Tested applicationsSuitable for: WB, IHC-P, Sandwich ELISA, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein (proprietary-tag) corresponding to Human DNA Polymerase Kappa/POLK aa 1-472.
    Sequence:

    MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFY GNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLS NTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRA AMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEA YLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISP LLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFR IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLP IRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISL GLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKER LKVLYFDMVSLVFKFFNSKMLP


    Database link: AAH50718

Properties

Applications

Our Abpromise guarantee covers the use of ab57070 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 99 kDa.
IHC-P Use a concentration of 3 µg/ml.
Sandwich ELISA Use at an assay dependent concentration.

Detection limit for recombinant tagged DNA Polymerase Kappa/POLK is approximately 0.3 ng/ml as a capture antibody

ICC/IF Use a concentration of 10 µg/ml.

Target

  • FunctionDNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. Lacks 3'-5' proofreading exonuclease activity. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have lyase activity.
  • Tissue specificityDetected at low levels in testis, spleen, prostate and ovary. Detected at very low levels in kidney, colon, brain, heart, liver, lung, placenta, pancreas and peripheral blood leukocytes.
  • Sequence similaritiesBelongs to the DNA polymerase type-Y family.
    Contains 2 UBZ-type zinc fingers.
    Contains 1 umuC domain.
  • DomainThe catalytic core consists of fingers, palm and thumb subdomains, but the fingers and thumb subdomains are much smaller than in high-fidelity polymerases; residues from five sequence motifs of the Y-family cluster around an active site cleft that can accommodate DNA and nucleotide substrates with relaxed geometric constraints, with consequently higher rates of misincorporation and low processivity.
  • Cellular localizationNucleus. Detected throughout the nucleus and at replication foci.
  • Information by UniProt
  • Database links
  • Alternative names
    • DinB homolog 1 (E. coli) antibody
    • DINB protein antibody
    • DINB1 antibody
    • DINP antibody
    • DNA damage inducible protein b antibody
    • DNA polymerase kappa antibody
    • Polk antibody
    • POLK_HUMAN antibody
    • POLQ antibody
    • Polymerase (DNA directed) kappa antibody
    • polymerase, DNA, kappa antibody
    see all

Anti-DNA Polymerase Kappa/POLK antibody images

  • Anti-DNA Polymerase Kappa/POLK antibody (ab57070) at 1 µg + HeLa nuclear lysate at 25 µg

    Secondary
    Goat Anti-Mouse IgG at 1/5000 dilution

    Predicted band size : 99 kDa
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human stomach tissue, staining DNA Polymerase Kappa/POLK with ab57070 at 3 µg/ml.

  • Immunofluorescence of HeLa cells, staining DNA Polymerase Kappa/POLK with ab57070 at 10 µg/ml.

  • All lanes : Anti-DNA Polymerase Kappa/POLK antibody (ab57070) at 5 µg/ml

    Lane 1 : DNA Polymerase Kappa/POLK-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    Goat Anti-Mouse IgG
    Developed using the ECL technique

    Predicted band size : 99 kDa
    Additional bands at : 54.1 kDa (possible isoform).
  • Detection limit for recombinant tagged DNA Polymerase Kappa/POLK is approximately 0.3 ng/mL as a capture antibody

References for Anti-DNA Polymerase Kappa/POLK antibody (ab57070)

This product has been referenced in:
  • Ziv O  et al. Identification of novel DNA-damage tolerance genes reveals regulation of translesion DNA synthesis by nucleophosmin. Nat Commun 5:5437 (2014). WB . Read more (PubMed: 25421715) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab57070.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"