Anti-DNA Polymerase lambda antibody (ab82919)

Overview

  • Product nameAnti-DNA Polymerase lambda antibody
    See all DNA Polymerase lambda primary antibodies
  • Description
    Rabbit polyclonal to DNA Polymerase lambda
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 525 - 574 (SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERD W) of Human DNA Polymerase lambda, (NP_037406)

  • Positive control
    • Fetal brain lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab82919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 63 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/12500.

Target

  • FunctionRepair polymerase. Involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity.
  • Tissue specificityExpressed in a number of tissues. Abundant in testis.
  • Sequence similaritiesBelongs to the DNA polymerase type-X family.
    Contains 1 BRCT domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • BETA N antibody
    • BETAN antibody
    • DNA directed DNA polymerase lambda antibody
    • DNA polymerase beta 2 antibody
    • DNA polymerase beta-2 antibody
    • DNA polymerase kappa antibody
    • DNA polymerase kappa DNA polymerase beta N antibody
    • DNA polymerase lambda antibody
    • DNA polymerase lamda2 antibody
    • DPOLL_HUMAN antibody
    • EC 2.7.7.7,EC 4.2.99. antibody
    • FLJ46002 antibody
    • OTTHUMP00000020321 antibody
    • OTTHUMP00000020323 antibody
    • OTTHUMP00000059179 antibody
    • Pol beta2 antibody
    • POL KAPPA antibody
    • Pol Lambda antibody
    • POLKAPPA antibody
    • POLL antibody
    • Polymerase DNA directed lambda antibody
    see all

Anti-DNA Polymerase lambda antibody images

  • Anti-DNA Polymerase lambda antibody (ab82919) at 1 µg/ml + fetal brain lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 63 kDa
    Observed band size : 63 kDa

References for Anti-DNA Polymerase lambda antibody (ab82919)

ab82919 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"