Overview

  • Product nameAnti-DNAJC1 antibody
    See all DNAJC1 primary antibodies
  • Description
    Rabbit polyclonal to DNAJC1
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 216-265 (

    KPQWHDLLPCKLGIWFCLTLKALPHLIQDAGQFYAKYKETRLKEKEDALT

    ) of Human DNAJC1

  • Positive control
    • Hela cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab81312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 64 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

Anti-DNAJC1 antibody images

  • Anti-DNAJC1 antibody (ab81312) at 1 µg/ml (in 5% skim milk / PBS buffer) + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 64 kDa
    Observed band size : 64 kDa

References for Anti-DNAJC1 antibody (ab81312)

ab81312 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81312.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"