Overview

  • Product name
    Anti-DNAL1 antibody [AT29E4]
    See all DNAL1 primary antibodies
  • Description
    Mouse monoclonal [AT29E4] to DNAL1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow, Xenopus laevis, Xenopus tropicalis
  • Immunogen

    Recombinant full length protein corresponding to Human DNAL1 aa 1-190. NP_113615. Purified from E. coli.
    Sequence:

    MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANC EKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWI SYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGN PLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN


    Database link: Q4LDG9

  • Positive control
    • HeLa, HepG2 and MCF7 cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: 89% PBS, 10% Glycerol
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Monoclonal
  • Clone number
    AT29E4
  • Isotype
    IgG2b
  • Light chain type
    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab183206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 22 kDa.

Target

Images

  • All lanes : Anti-DNAL1 antibody [AT29E4] (ab183206) at 1/1000 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : HepG2 cell lysate
    Lane 3 : MCF7 cell lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    Goat anti-mouse secondary antibody conjugated to HRP
    Developed using the ECL technique

    Predicted band size : 22 kDa

References

ab183206 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183206.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up