Overview

  • Product nameAnti-DOHH antibody
    See all DOHH primary antibodies
  • Description
    Rabbit polyclonal to DOHH
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Cat, Dog, Pig, Saccharomyces cerevisiae, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human DOHH aa 63-112 (N terminal).
    Sequence:

    GQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSS

  • Positive control
    • MDA-MB-43S5 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab122946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-DOHH antibody images

  • Anti-DOHH antibody (ab122946) at 1 µg/ml + MDA-MB-435S cell lysate at 10 µg

    Predicted band size : 33 kDa
    Gel concentration: 12%

References for Anti-DOHH antibody (ab122946)

ab122946 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"