Overview

  • Product name
  • Description
    Rabbit polyclonal to DOHH
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Cat, Dog, Pig, Saccharomyces cerevisiae, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human DOHH aa 63-112 (N terminal).
    Sequence:

    GQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSS

  • Positive control
    • MDA-MB-43S5 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab122946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-DOHH antibody (ab122946) at 1 µg/ml + MDA-MB-435S cell lysate at 10 µg

    Predicted band size : 33 kDa
    Gel concentration: 12%

References

ab122946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up