Overview

  • Product nameAnti-DOK6 antibody
    See all DOK6 primary antibodies
  • Description
    Rabbit polyclonal to DOK6
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 281-330 (

    IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI

    ) of Human DOK6 (NP_689934).

  • Positive control
    • COLO205 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab102621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 38 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceDOK6 (docking protein 6) is a novel member of the DOK4/5 subclass of the p62 DOK family of intracellular adaptor molecules. DOK6 is highly expressed in the developing central nervous system and is co expressed with Ret in several locations, including sympathetic, sensory, and parasympathetic ganglia, as well as in the ureteric buds of the developing kidneys. Pull down assays using the DOK6 phosphotyrosine binding (PTB) domain and GDNF activated Ret indicate that DOK6 binds to the phosphorylated Ret Tyr(1062) residue. Moreover, ligand activation of Ret resulted in phosphorylation of tyrosine residue(s) located within the unique C terminus of DOK6 predominantly through a Src dependent mechanism, indicating that DOK6 is a substrate of the Ret Src signaling pathway.
  • Database links
  • Alternative names
    • Docking protein 5 antibody
    • Docking protein 5 like antibody
    • Docking protein 6 antibody
    • DOK 6 antibody
    • DOK5 antibody
    • DOK5L antibody
    • DOK6 antibody
    • Downstream of tyrosine kinase 6 antibody
    • HsT3226 antibody
    • MGC20785 antibody
    • Protein dok 5 antibody
    see all

Anti-DOK6 antibody images

  • Anti-DOK6 antibody (ab102621) at 1 µg/ml + COLO205 cell lysate at 10 µg

    Predicted band size : 38 kDa

References for Anti-DOK6 antibody (ab102621)

ab102621 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"