Overview

  • Product nameAnti-DORFIN antibody
    See all DORFIN primary antibodies
  • Description
    Rabbit polyclonal to DORFIN
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 108-157 (

    IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD

    ) of Human DORFIN (NP_056250).

  • Positive control
    • Human fetal brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab83775 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 91 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre in peptide based assay is 1/1562500.

Target

  • FunctionE3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates, such as SNCAIP or CASR. Specifically ubiquitinates pathogenic SOD1 variants, which leads to their proteasomal degradation and to neuronal protection.
  • Tissue specificityWidely expressed, with highest levels in heart. Ubiquitously expressed in the central nervous system.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesBelongs to the RBR family. RNF19 subfamily.
    Contains 1 IBR-type zinc finger.
    Contains 2 RING-type zinc fingers.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationMembrane. Cytoplasm > cytoskeleton > centrosome. Present in the hyaline inclusion bodies specifically found in motor neurons from amyotrophic lateral sclerosis patients. Present in the Lewy bodies specifically found in neurons from Parkinson disease patients.
  • Information by UniProt
  • Database links
  • Alternative names
    • AA032313 antibody
    • DKFZP566B1346 antibody
    • Dorfin antibody
    • Double ring finger protein antibody
    • Double ring-finger protein antibody
    • E3 ubiquitin-protein ligase RNF19A antibody
    • p38 antibody
    • p38 protein antibody
    • Ring finger protein 19 antibody
    • RING finger protein 19A antibody
    • Ring IBR ring domain containing protein Dorfin antibody
    • RN19A_HUMAN antibody
    • RNF19 antibody
    • RNF19A antibody
    • Ubce7ip2 antibody
    • UIP117 antibody
    • XYbp antibody
    see all

Anti-DORFIN antibody images

  • Anti-DORFIN antibody (ab83775) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal brain lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 91 kDa
    Observed band size : 91 kDa

References for Anti-DORFIN antibody (ab83775)

ab83775 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83775.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"