Overview

  • Product name
  • Description
    Rabbit polyclonal to Dscam
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within amino acids 1547-1596 (

    MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV

    ) of Human Dscam (NP_001380).

  • Positive control
    • HepG2 cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab85362 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 222 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/1562500.

Target

  • Function
    Cell adhesion molecule that plays a role in neuronal self-avoidance. Promotes repulsion between specific neuronal processes of either the same cell or the same subtype of cells. Mediates within retinal amacrine and ganglion cell subtypes both isoneuronal self-avoidance for creating an orderly dendritic arborization and heteroneuronal self-avoidance to maintain the mosaic spacing between amacrine and ganglion cell bodies. Receptor for netrin required for axon guidance independently of and in collaboration with the receptor DCC. In spinal chord development plays a role in guiding commissural axons projection and pathfinding across the ventral midline to reach the floor plate upon ligand binding. Enhances netrin-induced phosphorylation of PAK1 and FYN. Mediates intracellular signaling by stimulating the activation of MAPK8 and MAP kinase p38.
  • Tissue specificity
    Primarily expressed in brain.
  • Sequence similarities
    Contains 6 fibronectin type-III domains.
    Contains 10 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain
    Ig-like C2-type domains 7 to 9 are sufficient for interaction with NTN1 and commissural axon outgrowth. The transmembrane domain is necessary for interaction with DCC.
  • Post-translational
    modifications
    Phosphorylated at tyrosine residues. Phosphorylation is enhanced by netrin.
  • Cellular localization
    Secreted and Cell membrane. Localized in the soma, cell membrane, axon and growth cone of dissociated commissural axons.
  • Information by UniProt
  • Database links
  • Alternative names
    • CHD2 42 antibody
    • CHD2 52 antibody
    • CHD2 antibody
    • Down syndrome cell adhesion molecule antibody
    • DSCAM antibody
    • DSCAM_HUMAN antibody
    • human CHD2-52 down syndrome cell adhesion molecule 2, 9 antibody
    • OTTHUMP00000109193 2 antibody
    • SD11109p antibody
    see all

Anti-Dscam antibody images

  • Anti-Dscam antibody (ab85362) at 1 µg/ml + 10 µg HepG2 cell lysate

    Secondary
    HRP conjugated anti-Rabbit IgG diluted 1/50,000.

    Predicted band size : 222 kDa

References for Anti-Dscam antibody (ab85362)

ab85362 has not yet been referenced specifically in any publications.

Product Wall

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (embryonic brain tissue, stage 10.5)
Specification
embryonic brain tissue, stage 10.5
Fixative
Paraformaldehyde
Permeabilization
Yes - 0.1% Tween
Blocking step
Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 4% · Temperature: 22°C
Username

Dr. Minkyung Kim

Verified customer

Submitted Jun 14 2010

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up