Overview

  • Product name
  • Description
    Mouse polyclonal to DUSP14
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human DUSP14 aa 1-198.
    Sequence:

    MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQA RGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSV SRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRP NVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI


    Database link: NP_008957.1

  • Positive control
    • DUSP14 transfected 293T cell lysate; HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab168969 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    Involved in the inactivation of MAP kinases. Dephosphorylates ERK, JNK and p38 MAP-kinases.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • Dual specificity phosphatase 14 antibody
    • Dual specificity protein phosphatase 14 antibody
    • DUS14_HUMAN antibody
    • DUSP 14 antibody
    • DUSP14 antibody
    • DUSP14 protein antibody
    • MAP kinase phosphatase 6 antibody
    • Mitogen activated protein kinase phosphatase 6 antibody
    • Mitogen-activated protein kinase phosphatase 6 antibody
    • MKP 1 like protein tyrosine phosphatase antibody
    • MKP 6 antibody
    • MKP L antibody
    • MKP-1-like protein tyrosine phosphatase antibody
    • MKP-6 antibody
    • MKP-L antibody
    • MKP1 like protein tyrosine phosphatase antibody
    • MKP6 antibody
    • MKPL antibody
    see all

Images

  • All lanes : Anti-DUSP14 antibody (ab168969) at 1 µg/ml

    Lane 1 : DUSP14 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Predicted band size: 22 kDa

  • Immunofluorescent analysis of HeLa cells labeling DUSP14 with ab168969 at 10 µg/ml.

References

ab168969 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168969.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up