Overview

  • Product nameAnti-DUSP19 antibody
    See all DUSP19 primary antibodies
  • Description
    Rabbit polyclonal to DUSP19
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Guinea pig, Cow, Cat, Human, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (

    MHSLNQEIKAFSRDNLRKQCTRVTTLTGKKLIETWKDATVHVVETETSGG

    ) of Rat DUSP19 (NP_001101209).

  • Positive control
    • Rat Muscle lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab118720 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionHas a dual specificity toward Ser/Thr and Tyr-containing proteins.
  • Tissue specificityExpressed in the heart, lung, liver, and pancreas. The expression level in the pancreas is the highest.
  • Sequence similaritiesBelongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • Dual specificity phosphatase 19 antibody
    • Dual specificity phosphatase TS DSP1 antibody
    • Dual specificity phosphatase TS-DSP1 antibody
    • Dual specificity protein phosphatase 19 antibody
    • DUS19_HUMAN antibody
    • DUSP 17 antibody
    • DUSP 19 antibody
    • DUSP17 antibody
    • Dusp19 antibody
    • LMW DSP3 antibody
    • LMW-DSP3 antibody
    • LMWDSP 3 antibody
    • LMWDSP3 antibody
    • Low molecular weight dual specificity phosphatase 3 antibody
    • MGC138210 antibody
    • Protein phosphatase SKRP1 antibody
    • SAPK pathway regulating phosphatase 1 antibody
    • SAPK pathway-regulating phosphatase 1 antibody
    • SKRP 1 antibody
    • SKRP1 antibody
    • Stress activated protein kinase pathway regulating phosphatase 1 antibody
    • Stress-activated protein kinase pathway-regulating phosphatase 1 antibody
    • TS DSP1 antibody
    see all

Anti-DUSP19 antibody images

  • Anti-DUSP19 antibody (ab118720) at 1 µg/ml + Rat Muscle lysate at 10 µg

    Predicted band size : 24 kDa

References for Anti-DUSP19 antibody (ab118720)

ab118720 has not yet been referenced specifically in any publications.

Product Wall

Application Western blot
Loading amount 100 µg
Gel Running Conditions Reduced Denaturing
Sample Mouse Cell lysate - whole cell (Brain)
Specification Brain
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C
Username

Abcam user community

Verified customer

Submitted Mar 24 2015

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"