Overview

  • Product name
  • Description
    Rabbit polyclonal to DUSP19
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Guinea pig, Cow, Cat, Human, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (

    MHSLNQEIKAFSRDNLRKQCTRVTTLTGKKLIETWKDATVHVVETETSGG

    ) of Rat DUSP19 (NP_001101209).

  • Positive control
    • Rat Muscle lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab118720 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Has a dual specificity toward Ser/Thr and Tyr-containing proteins.
  • Tissue specificity
    Expressed in the heart, lung, liver, and pancreas. The expression level in the pancreas is the highest.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • Dual specificity phosphatase 19 antibody
    • Dual specificity phosphatase TS DSP1 antibody
    • Dual specificity phosphatase TS-DSP1 antibody
    • Dual specificity protein phosphatase 19 antibody
    • DUS19_HUMAN antibody
    • DUSP 17 antibody
    • DUSP 19 antibody
    • DUSP17 antibody
    • Dusp19 antibody
    • LMW DSP3 antibody
    • LMW-DSP3 antibody
    • LMWDSP 3 antibody
    • LMWDSP3 antibody
    • Low molecular weight dual specificity phosphatase 3 antibody
    • MGC138210 antibody
    • Protein phosphatase SKRP1 antibody
    • SAPK pathway regulating phosphatase 1 antibody
    • SAPK pathway-regulating phosphatase 1 antibody
    • SKRP 1 antibody
    • SKRP1 antibody
    • Stress activated protein kinase pathway regulating phosphatase 1 antibody
    • Stress-activated protein kinase pathway-regulating phosphatase 1 antibody
    • TS DSP1 antibody
    see all

Images

  • Anti-DUSP19 antibody (ab118720) at 1 µg/ml + Rat Muscle lysate at 10 µg

    Predicted band size: 24 kDa



    12% SDS PAGE

References

ab118720 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Loading amount
100 µg
Gel Running Conditions
Reduced Denaturing
Sample
Mouse Cell lysate - whole cell (Brain)
Specification
Brain
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C
Username

Abcam user community

Verified customer

Submitted Mar 24 2015

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up