Overview

  • Product name
  • Description
    Mouse polyclonal to DUSP26
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Full length protein corresponding to Human DUSP26 aa 1-211. (NP_076930.1).
    Sequence:

    MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELER LLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWR GTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILV HCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLA LDRRLRQGLEA


    Database link: Q9BV47

  • Positive control
    • DUSP26 transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172670 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 24 kDa.

Target

  • Function
    Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).
  • Tissue specificity
    Brain. In the brain it is expressed ubiquitously except in the hippocampus. Expressed in embryonal cancers (retinoblastoma, neuroepithilioma and neuroblastoma) and in anaplatic thyroid cancer.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization
    Cytoplasm. Nucleus. Golgi apparatus.
  • Information by UniProt
  • Database links
  • Alternative names
    • DSP-4 antibody
    • Dual specificity phosphatase 26 (putative) antibody
    • Dual specificity phosphatase 26 antibody
    • Dual specificity phosphatase SKRP3 antibody
    • Dual specificity protein phosphatase 26 antibody
    • DUS26_HUMAN antibody
    • DUSP24 antibody
    • DUSP26 antibody
    • Hypothetical protein FLJ31142 antibody
    • LDP 4 antibody
    • LDP-4 antibody
    • Low molecular mass dual specificity phosphatase 4 antibody
    • Low-molecular-mass dual-specificity phosphatase 4 antibody
    • MAP kinase phosphatase 8 antibody
    • MGC1136 antibody
    • MGC2627 antibody
    • Mitogen activated protein kinase phosphatase 8 antibody
    • Mitogen-activated protein kinase phosphatase 8 antibody
    • MKP-8 antibody
    • MKP8 antibody
    • NATA1 antibody
    • NATA1 protein antibody
    • Novel amplified gene in thyroid anaplastic cancer antibody
    • SKRP3 antibody
    see all

Images

  • All lanes : Anti-DUSP26 antibody (ab172670) at 1/500 dilution

    Lane 1 : DUSP26 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 24 kDa

References

ab172670 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172670.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up