Overview

  • Product name
    Anti-DUXA antibody
  • Description
    Rabbit polyclonal to DUXA
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 154-203 (SRLLLQRKREPVASLEQEEQGKIPEGLQGAEDTQNGTNFTSDSHFSGAR T) of Human DUXA (NP_001012747)

  • Positive control
    • Human fetal stomach lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-DUXA antibody (ab99058) at 1 µg/ml + Human fetal stomach lysate at 10 µg

    Predicted band size : 24 kDa

References

ab99058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up