
  • Product name
    Anti-DUXA antibody
  • Description
    Rabbit polyclonal to DUXA
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 154-203 (SRLLLQRKREPVASLEQEEQGKIPEGLQGAEDTQNGTNFTSDSHFSGAR T) of Human DUXA (NP_001012747)

  • Positive control
    • Human fetal stomach lysate



Our Abpromise guarantee covers the use of ab99058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-DUXA antibody images

  • Anti-DUXA antibody (ab99058) at 1 µg/ml + Human fetal stomach lysate at 10 µg

    Predicted band size : 24 kDa

References for Anti-DUXA antibody (ab99058)

ab99058 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99058.
Please use the links above to contact us or submit feedback about this product.


Sign up