Overview

  • Product nameAnti-Dynein light chain antibody
    See all Dynein light chain primary antibodies
  • Description
    Rabbit polyclonal to Dynein light chain
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 51-100 (

    ESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVC

    ) of Human Dnalc4 (Q9DCM4, NP_059498).

  • Positive control
    • Mouse small intestine lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab125428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 12 kDa (predicted molecular weight: 12 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Dynein light chain antibody images

  • Anti-Dynein light chain antibody (ab125428) at 1 µg/ml + Mouse small intestine lysate at 10 µg with Milk at 5 %

    Predicted band size : 12 kDa
    Observed band size : 12 kDa

References for Anti-Dynein light chain antibody (ab125428)

This product has been referenced in:
  • Kim HY  et al. CXXC5 is a transcriptional activator of Flk-1 and mediates bone morphogenic protein-induced endothelial cell differentiation and vessel formation. FASEB J 28:615-26 (2014). WB ; Mouse . Read more (PubMed: 24136587) »

See 1 Publication for this product

Product Wall

Thank you for contacting Abcam.

Please find a list of possible alternatives below:

ab7973 alternative
http://www.abcam.com/Bcl2-antibody-ab18210.html
http://www.abcam.com/Bcl2-antibody-ab47489.html
http://www.abcam.com/Bcl...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"