Overview

  • Product name
  • Description
    Rabbit polyclonal to DYNLL1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Caenorhabditis elegans, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 36-85 (

    KDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILL

    ) of Human DLC8 (NP_001032583).

  • Positive control
    • Transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab87283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 10 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
    Binds and inhibits the catalytic activity of neuronal nitric oxide synthase.
    Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1.
    Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the dynein light chain family.
  • Post-translational
    modifications
    Phosphorylation at Ser-88 appears to control the dimer-monomer transition. According to PubMed:15193260, it is phosphorylated at Ser-88 by PAK1, however, according to PubMed:18650427, the DYNLL1 dimer is not accessible for PAK1 and the phosphorylation could not be demonstrated in vitro.
  • Cellular localization
    Cytoplasm, cytoskeleton. Nucleus. Mitochondrion. Upon induction of apoptosis translocates together with BCL2L11 to mitochondria.
  • Information by UniProt
  • Database links
  • Alternative names
    • 8 kDa dynein light chain antibody
    • 8kDLC antibody
    • Cytoplasmic dynein light polypeptide antibody
    • DLC1 antibody
    • DLC8 antibody
    • DNCL1 antibody
    • DNCLC1 antibody
    • DYL1_HUMAN antibody
    • Dynein , cytoplasmic, light chain 1 antibody
    • Dynein light chain 1 cytoplasmic antibody
    • Dynein light chain 1, cytoplasmic antibody
    • Dynein light chain LC8 type 1 antibody
    • Dynein light chain LC8-type 1 antibody
    • Dynein, cytoplasmic, light polypeptide 1 antibody
    • Dynein, light chain, LC8-type 1 antibody
    • DYNLL1 antibody
    • HDLC1 antibody
    • LC8 antibody
    • LC8a antibody
    • MGC126137 antibody
    • MGC126138 antibody
    • MGC72986 antibody
    • PIN antibody
    • Protein inhibitor of neuronal nitric oxide synthase antibody
    • Protein inhibitor of neuronal NOS antibody
    see all

Images

  • Anti-DYNLL1 antibody (ab87283) at 1 µg/ml + Transfected 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 10 kDa
    Observed band size : 10 kDa

References

ab87283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab87283.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up