Overview

  • Product nameAnti-DYRK1A antibody [7D10]
    See all DYRK1A primary antibodies
  • Description
    Mouse monoclonal [7D10] to DYRK1A
  • Tested applicationsSuitable for: WB, IP, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DYRK1A aa 674-763.
    Sequence:

    NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFS ANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS


    Database link: Q13627

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferpH: 7.4
    Constituent: PBS
  • Concentration information loading...
  • PurityProtein G purified
  • ClonalityMonoclonal
  • Clone number7D10
  • IsotypeIgG2b
  • Light chain typekappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab54944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 86 kDa.
IP Use at an assay dependent concentration. PubMed: 20053746
Flow Cyt Use 1µg for 106 cells. ab170192-Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.

Target

  • FunctionMay play a role in a signaling pathway regulating nuclear functions of cell proliferation. Phosphorylates serine, threonine and tyrosine residues in its sequence and in exogenous substrates.
  • Tissue specificityUbiquitous. Highest levels in skeletal muscle, testis, fetal lung and fetal kidney.
  • Involvement in diseaseDefects in DYRK1A are the cause of mental retardation autosomal dominant type 7 (MRD7) [MIM:614104]. A disease characterized by primary microcephaly, severe mental retardation without speech, anxious autistic behavior, and dysmorphic features, including bitemporal narrowing, deep-set eyes, large simple ears, and a pointed nasal tip. Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period.
  • Sequence similaritiesBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily.
    Contains 1 protein kinase domain.
  • Developmental stageExpressed in the developing central nervous system. Overexpressed 1.5-fold in fetal Down syndrome brain.
  • DomainThe polyhistidine repeats act as targeting signals to nuclear speckles (PubMed:19266028).
  • Post-translational
    modifications
    Autophosphorylated on tyrosine residues.
  • Cellular localizationNucleus speckle.
  • Information by UniProt
  • Database links
  • Alternative names
    • Dual specificity tyrosine phosphorylation regulated kinase antibody
    • Dual specificity tyrosine (Y) phosphorylation regulated kinase 1A antibody
    • Dual specificity tyrosine phosphorylation regulated kinase 1 antibody
    • Dual specificity tyrosine phosphorylation regulated kinase 1A antibody
    • Dual specificity tyrosine-phosphorylation-regulated kinase 1A antibody
    • Dual specificity YAK 1 related kinase antibody
    • Dual specificity YAK1 related kinase antibody
    • Dual specificity YAK1-related kinase antibody
    • DYR1A_HUMAN antibody
    • DYRK 1 antibody
    • DYRK 1A antibody
    • DYRK antibody
    • DYRK1 antibody
    • Dyrk1a antibody
    • DYRKA antibody
    • hMNB antibody
    • HP 86 antibody
    • HP86 antibody
    • Minibrain (Drosophila) homolog antibody
    • Minibrain homolog antibody
    • Minibrain, Drosophila, homolog of antibody
    • MNB antibody
    • MNB protein kinase antibody
    • Mnb protein kinase homolog hp86 antibody
    • MNB protein kinase, Serine/threonine-specific antibody
    • MNB/DYRK protein kinase antibody
    • MNBH antibody
    • MRD7 antibody
    • OTTHUMP00000109090 antibody
    • OTTHUMP00000109091 antibody
    • OTTHUMP00000109094 antibody
    • OTTHUMP00000174799 antibody
    • Protein kinase minibrain homolog antibody
    • Serine/threonine kinase MNB antibody
    see all

Anti-DYRK1A antibody [7D10] images



  • Predicted band size : 86 kDa
    DYRK1A antibody (ab54944) at 1ug/lane + HeLa cell lysate at 25ug/lane.
  • Overlay histogram showing HeLa cells stained with ab54944 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab54944, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2b [PLPV219] (ab91366, 2µg/1x106 cells ) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4% paraformaldehyde (10 min)/permeabilized in 0.1% PBS-Tween used under the same conditions.

References for Anti-DYRK1A antibody [7D10] (ab54944)

This product has been referenced in:
  • Komorek J  et al. Adenovirus type 5 E1A and E6 proteins of low-risk cutaneous beta-human papillomaviruses suppress cell transformation through interaction with FOXK1/K2 transcription factors. J Virol 84:2719-31 (2010). WB, IP ; Human . Read more (PubMed: 20053746) »

See 1 Publication for this product

Product Wall

Thank you for contacting us.

I can confirm the protein ab114522 is exactly the immunising peptide for ab54944 and could therefore serve as a positive control.

I hope this information was helpful. Please do not hesitate to contact us...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"