E. coli E. coli serine protease inhibitor full length protein (ab103303)

Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionP23827
    • SpeciesEscherichia coli
    • SequenceMGSSHHHHHHSSGLVPRGSHMAESVQPLEKIAPYPQAEKGMKRQVIQLTP QEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSS PVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRV WKAEEKIDNAVVR
    • Molecular weight18 kDa including tags
    • Amino acids21 to 162
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103303 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % by SDS-PAGE.
    ab103303 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General info

  • Alternative names
    • ECK2201
    • Ecotin
    • Ecotin, a serine protease inhibitor
    • eti
    • JW2197
    see all
  • RelevanceE. coli serine protease inhibitor (Ecotin) inhibits pancreatic serine proteases: inhibits chymotrypsin, trypsin, elastases, factor X, kallikrein as well as a variety of other proteases. The strength of inhibition does not appear to be correlated with a particular protease specificity.
  • Cellular localizationPeriplasm.

E. coli E. coli serine protease inhibitor full length protein images

  • 15% SDS-PAGE analysis of 3µg ab103303.

References for E. coli E. coli serine protease inhibitor full length protein (ab103303)

ab103303 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103303.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"