Anti-E. coli ethanolamine ammonia lyase light chain antibody (ab193642)

Overview

  • Product name
    Anti-E. coli ethanolamine ammonia lyase light chain antibody
    See all E. coli ethanolamine ammonia lyase light chain primary antibodies
  • Description
    Rabbit polyclonal to E. coli ethanolamine ammonia lyase light chain
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli E. coli ethanolamine ammonia lyase light chain aa 1-295.
    Sequence:

    MDQKQIEEIVRSVMASMGQAAPAPSEAKCATTNCAAPVTSESCALDLGSA EAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHS RSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEA LKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPF FVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMAT TVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR


    Database link: P19636

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    >95%,Protein G purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 32 kDa.
ELISA Use at an assay dependent concentration.

Target

  • Relevance
    The ethanolamine ammonialyase microcompartment of Escherichia coli represents such a class of cytosolic organelles that enables bacteria to survive on small organic molecules such as ethanolamine as the sole source for carbon and nitrogen.
  • Database links
    • Alternative names
      • Ethanolamine ammonia-lyase light chain antibody
      • Ethanolamine ammonia-lyase small subunit antibody
      • Ethanolamine ammonia-lyase, small subunit (light chain) antibody

    Images

    • All lanes : Anti-E. coli ethanolamine ammonia lyase light chain antibody (ab193642) at 3 µg/ml

      Lane 1 : Rosseta bacteria lysate at 80 µg
      Lane 2 : Rosseta bacteria lysate at 40 µg
      Lane 3 : Rosseta bacteria lysate at 20 µg
      Lane 4 : Rosseta bacteria lysate at 10 µg

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/5000 dilution

      Predicted band size: 32 kDa
      Observed band size: 32 kDa

    References

    ab193642 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193642.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up