Overview

  • Product name
  • Description
    Rabbit polyclonal to E2F4
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human E2F4 aa 328-404.
    Sequence:

    GPNPSTSFEPIKADPTGVLELPKELSEIFDPTRECMSSELLEELMSSEVF APLLRLSPPPGDHDYIYNLDESEGVCD


    Database link: Q16254

  • Positive control
    • HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Function
    Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F-4 binds with high affinity to RBL1 and RBL2. In some instances, can also bind RB protein.
  • Tissue specificity
    Found in all tissue examined including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities
    Belongs to the E2F/DP family.
  • Developmental stage
    Present in the growth-arrested state, its abundance does not change significantly as cells move into and through the cell cycle.
  • Post-translational
    modifications
    Differentially phosphorylated in vivo.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • E2F 4 antibody
    • E2F transcription factor 4 antibody
    • E2F transcription factor 4 p107/p130 binding antibody
    • E2F-4 antibody
    • E2F4 antibody
    • E2F4_HUMAN antibody
    • p107/p130 binding protein antibody
    • Transcription factor E2F 4 antibody
    • Transcription factor E2F4 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HeLa cells labeling E2F4 with ab220674 at 4 µg/ml (green).

References

ab220674 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up