Overview

  • Product name
  • Description
    Rabbit polyclonal to E2F8
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human E2F8 aa 1-867.
    Sequence:

    MENEKENLFCEPHKRGLMKTPLKESTTANIVLAEIQPDFGPLTTPTKPKE GSQGEPWTPTANLKMLISAVSPEIRNRDQKRGLFDNRSGLPEAKDCIHEH LSGDEFEKSQPSRKEKSLGLLCHKFLARYPNYPNPAVNNDICLDEVAEEL NVERRRIYDIVNVLESLHMVSRLAKNRYTWHGRHNLNKTLGTLKSIGEEN KYAEQIMMIKKKEYEQEFDFIKSYSIEDHIIKSNTGPNGHPDMCFVELPG VEFRAASVNSRKDKSLRVMSQKFVMLFLVSTPQIVSLEVAAKILIGEDHV EDLDKSKFKTKIRRLYDIANVLSSLDLIKKVHVTEERGRKPAFKWTGPEI SPNTSGSSPVIHFTPSDLEVRRSSKENCAKNLFSTRGKPNFTRHPSLIKL VKSIESDRRKINSAPSSPIKTNKAESSQNSAPFPSKMAQLAAICKMQLEE QSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSLIQPLGMVPLI PSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSVTPPQGLSPTVCTTHSS KATGSKDSTDATTEKAANDTSKASASTRPGSLLPAPERQGAKSRTREPAG ERGSKRASMLEDSGSKKKFKEDLKGLENVSATLFPSGYLIPLTQCSSLGA ESILSGKENSSALSPNHRIYSSPIAGVIPVTSSELTAVNFPSFHVTPLKL MVSPTSVAAVPVGNSPALASSHPVPIQNPSSAIVNFTLQHLGLISPNVQL SASPGSGIVPVSPRIESVNVAPENAGTQQGRATNYDSPVPGQSQPNGQSV AVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMDFEGANKTSLG TLFVPQRKLEVSTEDVH


    Database link: A0AVK6

  • Positive control
    • HeLa cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab185727 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 94 kDa.

Target

  • Function
    Along with E2F7, inhibitor of E2F-dependent transcription. Binds DNA independently of DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3'. Directly represses E2F1 transcription. Appears to regulate a subset of E2F-dependent genes whose products are required for normal cell cycle progession.
  • Sequence similarities
    Belongs to the E2F/DP family.
  • Domain
    Both DNA-binding domains are required for DNA-binding and are proposed to form an intramolecular structure that is similar to the winged helix structure of the E2F-DP heterodimer.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • E2F 8 antibody
    • E2F family member 82 antibody
    • E2F transcription factor 8 antibody
    • E2F-8 antibody
    • E2f8 antibody
    • E2F8_HUMAN antibody
    • FLJ23311 antibody
    • Transcription factor E2F8 antibody
    see all

Images

  • Anti-E2F8 antibody (ab185727) at 1/500 dilution + HeLa cell lysate

    Predicted band size : 94 kDa

References

This product has been referenced in:
  • Sun J  et al. E2F8, a direct target of miR-144, promotes papillary thyroid cancer progression via regulating cell cycle. J Exp Clin Cancer Res 36:40 (2017). Read more (PubMed: 28270228) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185727.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up