Anti-E3 ubiquitin-protein ligase MUL1 antibody (ab84067)


  • Product name
    Anti-E3 ubiquitin-protein ligase MUL1 antibody
    See all E3 ubiquitin-protein ligase MUL1 primary antibodies
  • Description
    Rabbit polyclonal to E3 ubiquitin-protein ligase MUL1
  • Tested applications
    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 215-264 (GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYL Q) of Human C1orf166 (NP_078820)

  • Positive control
    • WB: Human fetal heart tissue lysate. IHC-P: Human breast carcinoma tissue.



Our Abpromise guarantee covers the use of ab84067 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa.Can be blocked with Human E3 ubiquitin-protein ligase MUL1 peptide (ab197726). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ICC/IF Use a concentration of 5 µg/ml.
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.


  • Function
    Exhibits weak E3 ubiquitin-protein ligase activity, but preferentially acts as a SUMO E3 ligase at physiological concentrations. Plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
  • Tissue specificity
    Widely expressed with highest levels in the heart, skeletal muscle, placenta, kidney and liver. Barely detectable in colon and thymus.
  • Pathway
    Protein modification; protein ubiquitination.
    Protein modification; protein sumoylation.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
  • Domain
    The zinc finger domain is required for E3 ligase activity.
  • Cellular localization
    Mitochondrion outer membrane. Peroxisome. Transported in mitochondrion-derived vesicles from the mitochondrion to the peroxisome.
  • Information by UniProt
  • Database links
  • Alternative names
    • 0610009K11Rik antibody
    • AV000801 antibody
    • C1orf166 antibody
    • Chromosome 1 open reading frame 166 antibody
    • E3 SUMO-protein ligase MUL1 antibody
    • E3 ubiquitin ligase antibody
    • E3 ubiquitin protein ligase MUL1 antibody
    • E3 ubiquitin-protein ligase MUL1 antibody
    • FLJ12875 antibody
    • GIDE antibody
    • Growth inhibition and death E3 ligase antibody
    • MAPL antibody
    • Mitochondrial anchored protein ligase antibody
    • mitochondrial E3 ubiquitin ligase 1 antibody
    • mitochondrial E3 ubiquitin protein ligase 1 antibody
    • Mitochondrial ubiquitin ligase activator of NFKB 1 antibody
    • Mitochondrial-anchored protein ligase antibody
    • MUL1 antibody
    • MUL1_HUMAN antibody
    • MULAN antibody
    • Putative NF kappa B activating protein 266 antibody
    • Putative NF-kappa-B-activating protein 266 antibody
    • RGD1309944 antibody
    • RING finger protein 218 antibody
    • RNF218 antibody
    • RP11-401M16.2 antibody
    • RP23-25C1.10-002 antibody
    see all

Anti-E3 ubiquitin-protein ligase MUL1 antibody images

  • Predicted band size : 40 kDa
    Western blot analysis of Human fetal heart lysate labeling C1orf166 at ab84067 at 1.0µg/ml.
  • IHC image of ab84067 staining in human breast carcinoma formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab84067, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

References for Anti-E3 ubiquitin-protein ligase MUL1 antibody (ab84067)

This product has been referenced in:
  • Hooper CL  et al. Modulation of stretch-induced myocyte remodeling and gene expression by nitric oxide: a novel role for lipoma preferred partner in myofibrillogenesis. Am J Physiol Heart Circ Physiol 304:H1302-13 (2013). Rat . Read more (PubMed: 23504181) »

See 1 Publication for this product

Product Wall

Western blot
Loading amount
60 µg
Gel Running Conditions
Reduced Denaturing (10% acrylamide)
Mouse Tissue lysate - whole (Muscle)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Jul 10 2013

Yes, product ab110337 can be used as positive control.

Please recommend this to customer and then letting us know the results.

Many thanks for your cooperation. I will look forward to hearing from you soon.


Sign up