Overview

  • Product name
  • Description
    Sheep polyclonal to EBF2
  • Host species
    Sheep
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Cow, Human, Xenopus laevis, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human EBF2 aa 407-519. (Derived from E.coli).
    Sequence:

    RNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGYIRNTSSI SPRGYSSSSTPQQSNYSTSSNSMNGYSNVPMANLGVPGSPGFLNGSPTGS PYGIMSSSPTVGS


    Database link: Q9HAK2

  • Positive control
    • Mouse embryonic tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab215061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Detects a band of approximately 65 kDa (predicted molecular weight: 63 kDa).

Target

Images

References

ab215061 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215061.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up