Overview

  • Product nameAnti-ECHDC2 antibody
    See all ECHDC2 primary antibodies
  • Description
    Rabbit polyclonal to ECHDC2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Pig
  • Immunogen

    Synthetic peptide corresponding to a region from internal sequence amino acids 144-193 (

    QRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQRA

    ) of Human ECHDC2 (NP_060751).

  • Positive control
    • THP1 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceECHDC2 belongs to the enoyl-CoA hydratase/isomerase family. There are two named isforms.
  • Cellular localizationMitochondrion
  • Database links
  • Alternative names
    • 1300017C12Rik antibody
    • 2610009M20Rik antibody
    • D4Ertd765e antibody
    • Enoyl Coenzyme A hydratase domain containing 2 antibody
    • FLJ10948 antibody
    • RGD1308525 antibody
    • RP23-379K6.3 antibody
    see all

Anti-ECHDC2 antibody images

  • Anti-ECHDC2 antibody (ab90044) at 1 µg/ml (5% skim milk / PBS buffer) + THP1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 28 kDa

References for Anti-ECHDC2 antibody (ab90044)

ab90044 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90044.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"