Anti-S1P1/EDG1 antibody (ab137467)
Key features and details
- Rabbit polyclonal to S1P1/EDG1
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-S1P1/EDG1 antibody
See all S1P1/EDG1 primary antibodies -
Description
Rabbit polyclonal to S1P1/EDG1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Synthetic peptide corresponding to S1P1/EDG1 aa 303-382.
Sequence:NSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSR SKSDNSSHPQKDEGDNPETIMSSGNVNSSS
Database link: P21453 -
Positive control
- HepG2 whole cell lysate, mouse brain tissue
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 79.99% PBS, 20% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab137467 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/3000. Predicted molecular weight: 43 kDa.
|
|
IHC-P |
1/100 - 1/1000.
|
Notes |
---|
WB
1/500 - 1/3000. Predicted molecular weight: 43 kDa. |
IHC-P
1/100 - 1/1000. |
Target
-
Function
Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. This inducible epithelial cell G-protein-coupled receptor may be involved in the processes that regulate the differentiation of endothelial cells. Seems to be coupled to the G(i) subclass of heteromeric G proteins. -
Tissue specificity
Endothelial cells, and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. -
Post-translational
modificationsS1P-induced endothelial cell migration requires the PKB/AKT1-mediated phosphorylation of the third intracellular loop at the Thr-236 residue. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 1901 Human
- Entrez Gene: 13609 Mouse
- Omim: 601974 Human
- SwissProt: P21453 Human
- SwissProt: O08530 Mouse
- Unigene: 154210 Human
- Unigene: 982 Mouse
-
Alternative names
- CD363 antibody
- CHEDG 1 antibody
- CHEDG1 antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab137467 has been referenced in 3 publications.
- Patrone M et al. Combinatorial allosteric modulation of agonist response in a self-interacting G-protein coupled receptor. Commun Biol 3:27 (2020). PubMed: 31941999
- Hiramatsu-Asano S et al. Deletion of Mir223 Exacerbates Lupus Nephritis by Targeting S1pr1 in Faslpr/lpr Mice. Front Immunol 11:616141 (2020). PubMed: 33574820
- Christensen PM et al. Impaired endothelial barrier function in apolipoprotein M-deficient mice is dependent on sphingosine-1-phosphate receptor 1. FASEB J 30:2351-9 (2016). PubMed: 26956418