
  • Product name
  • Description
    Rabbit polyclonal to EFEMP1
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 395-444 (KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSP V) of Human EFEMP1 (NP_004096).

  • Positive control
    • 721_B cell lysate



Our Abpromise guarantee covers the use of ab83087 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 53 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ICC/IF Use at an assay dependent concentration. PubMed: 22665518


  • Function
    Binds EGFR, the EGF receptor, inducing EGFR autophosphorylation and the activation of downstream signaling pathways. May play a role in cell adhesion and migration. May function as a negative regulator of chondrocyte differentiation. In the olfactory epithelium, it may regulate glial cell migration, differentiation and the ability of glial cells to support neuronal neurite outgrowth.
  • Tissue specificity
    In the eye, associated with photoreceptor outer and inner segment regions, the nerve fiber layer, outer nuclear layer and inner and outer plexiform layers of the retina.
  • Involvement in disease
    Defects in EFEMP1 are a cause of Doyne honeycomb retinal dystrophy (DHRD) [MIM:126600]; also known as malattia leventinese (MLVT) (ML). DHRD is an autosomal dominant disease characterized by yellow-white deposits known as drusen that accumulate beneath the retinal pigment epithelium.
  • Sequence similarities
    Belongs to the fibulin family.
    Contains 6 EGF-like domains.
  • Cellular localization
    Secreted > extracellular space. Secreted > extracellular space > extracellular matrix. Localizes to the lamina propria underneath the olfactory epithelium.
  • Information by UniProt
  • Database links
  • Alternative names
    • DHRD antibody
    • Doyne honeycomb retinal degeneration antibody
    • DRAD antibody
    • EFEMP 1 antibody
    • EFEMP1 antibody
    • EGF containing fibulin like extracellular matrix protein 1 antibody
    • EGF containing fibulin like extracellular matrix protein 1 precursor antibody
    • EGF-containing fibulin-like extracellular matrix protein 1 antibody
    • Epidermal growth factor containing fibulin like extracellular matrix protein 1 antibody
    • Extracellular protein S1 5 antibody
    • Extracellular protein S1-5 antibody
    • FBLN 3 antibody
    • FBLN3 antibody
    • FBLN3_HUMAN antibody
    • FBNL antibody
    • FIBL 3 antibody
    • FIBL-3 antibody
    • FIBL3 antibody
    • Fibrillin like antibody
    • Fibrillin like protein antibody
    • Fibrillin-like protein antibody
    • FIBULIN 3 antibody
    • Fibulin-3 antibody
    • Fibulin3 antibody
    • FLJ35535 antibody
    • Heat shock 70 KD protein 1 antibody
    • MGC111353 antibody
    • MLVT antibody
    • MTLV antibody
    • S1 5 antibody
    • T16 protein antibody
    see all

Anti-EFEMP1 antibody images

References for Anti-EFEMP1 antibody (ab83087)

This product has been referenced in:
  • Lutter S  et al. Smooth muscle-endothelial cell communication activates Reelin signaling and regulates lymphatic vessel formation. J Cell Biol 197:837-49 (2012). WB, ICC/IF ; Mouse . Read more (PubMed: 22665518) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab83087.
Please use the links above to contact us or submit feedback about this product.


Sign up