
  • Product nameAnti-EFHA2 antibody
    See all EFHA2 primary antibodies
  • Description
    Rabbit polyclonal to EFHA2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 36-85 (LGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQ L) of Human EFHA2 (NP_859074).

  • Positive control
    • HepG2 cell lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products


Our Abpromise guarantee covers the use of ab89868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 61 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-EFHA2 antibody images

  • Anti-EFHA2 antibody (ab89868) at 1 µg/ml + HepG2 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 61 kDa
    Observed band size : 61 kDa
    Additional bands at : 45 kDa. We are unsure as to the identity of these extra bands.

References for Anti-EFHA2 antibody (ab89868)

ab89868 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab89868.
Please use the links above to contact us or submit feedback about this product.