Overview

  • Product name
    Anti-EFHA2 antibody
  • Description
    Rabbit polyclonal to EFHA2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Cat, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 72-121 (

    AAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIPV

    ) of Human EFHA2 (NP_859074)

  • Positive control
    • 293T cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab89869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 61 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-EFHA2 antibody images

  • Anti-EFHA2 antibody (ab89869) at 1 µg/ml + 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 61 kDa

References for Anti-EFHA2 antibody (ab89869)

ab89869 has not yet been referenced specifically in any publications.

Product Wall

Application
Western blot
Loading amount
50 µg
Gel Running Conditions
Non-reduced Denaturing (4-12% BIS-TRIS)
Sample
Human Cell lysate - whole cell (fibroblasts)
Specification
fibroblasts
Blocking step
Milk as blocking agent for 16 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C
Username

Abcam user community

Verified customer

Submitted Feb 25 2014

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up