Overview

  • Product name
    Anti-EI2BL antibody
  • Description
    Rabbit polyclonal to EI2BL
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Cow, Cynomolgus monkey
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human EI2BL aa 272-361.
    Sequence:

    HGIPFYVAAPSSSCDLRLETGKEIIIEERPGQELTDVNGVRIAAPGIGVW NPAFDVTPHDLITGGIITELGVFAPEELRTALTTTISSRD


    Database link: Q9BV20

  • Positive control
    • Human thyroid gland tissue; RT-4, U-251MG sp cell lysates; U-2 OS cell line

Properties

Applications

Our Abpromise guarantee covers the use of ab187894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
WB 1/100 - 1/250.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Catalyzes the interconversion of methylthioribose-1-phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P). Independently from catalytic activity, promotes cell invasion in response to constitutive RhoA activation by promoting FAK tyrosine phosphorylation and stress fiber turnover.
  • Pathway
    Amino-acid biosynthesis; L-methionine biosynthesis via salvage pathway; L-methionine from S-methyl-5-thio-alpha-D-ribose 1-phosphate: step 1/6.
  • Sequence similarities
    Belongs to the eIF-2B alpha/beta/delta subunits family. MtnA subfamily.
  • Cellular localization
    Nucleus. Cytoplasm. Cell projection. Primarily nuclear, but cytoplasmic in cancer cells, with enrichment at leading edge of the plasma membrane in late stage tumor cells.
  • Information by UniProt
  • Database links
  • Alternative names
    • EI2BL antibody
    • M1Pi antibody
    • Mediator of RhoA-dependent invasion antibody
    • Methylthioribose 1 phosphate isomerase 1 antibody
    • Methylthioribose 1 phosphate isomerase homolog antibody
    • Methylthioribose-1-phosphate isomerase antibody
    • MGC3207 antibody
    • MRDI antibody
    • mri1 antibody
    • MTNA antibody
    • MTNA_HUMAN antibody
    • MTR-1-P isomerase antibody
    • S methyl 5 thioribose 1 phosphate isomerase 1 antibody
    • S-methyl-5-thioribose-1-phosphate isomerase antibody
    • Translation initiation factor eIF 2B antibody
    • Translation initiation factor eIF-2B subunit alpha/beta/delta-like protein antibody
    • Ypr118w antibody
    see all

Images

  • All lanes : Anti-EI2BL antibody (ab187894) at 1/1000 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251MG sp cell lysate
  • Immunofluorescent analysis of Human cell line U-2 OS labeling EI2BL with ab187894 at 4µg/ml. 

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded Human thyroid gland tssue labeling EI2BL with ab187894 at 1/1000 dilution.

References

ab187894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up