Overview

  • Product name
  • Description
    Rabbit polyclonal to EID1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human EID1 aa 1-97.
    Sequence:

    MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQ QLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESED


    Database link: Q9Y6B2

  • Positive control
    • Human testis tissue; U2OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab188024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function
    Interacts with RB1 and EP300 and acts as a repressor of MYOD1 transactivation. Inhibits EP300 and CBP histone acetyltransferase activity. May be involved in coupling cell cycle exit to the transcriptional activation of genes required for cellular differentiation. May act as a candidate coinhibitory factor for NR0B2 that can be directly linked to transcription inhibitory mechanisms.
  • Tissue specificity
    Widely expressed. Most abundantly expressed in heart, skeletal muscle, pancreas, brain and testis. Expressed at much lower levels in placenta and peripheral blood leukocyte. Barely detectable in lung. Also weakly expressed in lung carcinoma A549 and various leukemia cell lines.
  • Developmental stage
    Expression decreased with development in ventricular tissue while remaining highly expressed in adult atrial tissue. In primary cultures of human skeletal myocytes, expression decreased during myogenic differentiation (at protein level).
  • Post-translational
    modifications
    Ubiquitinated in U-2OS osteosarcoma cells and is rapidly degraded by proteasome as cells exit the cell cycle exit.
  • Cellular localization
    Nucleus. Cytoplasm. May shuttle between nucleus and cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • 21 kDa pRb associated protein antibody
    • 21 kDa pRb-associated protein antibody
    • C15orf3 antibody
    • CBP antibody
    • Chromosome 15 open reading frame 3 antibody
    • CREBBP/EP300 inhibitor 1 antibody
    • CREBBP/EP300 inhibitory protein 1 antibody
    • CRI 1 antibody
    • CRI1 antibody
    • E1A like inhibitor of differentiation antibody
    • E1A-like inhibitor of differentiation 1 antibody
    • EID 1 antibody
    • EID-1 antibody
    • EID1 antibody
    • EID1_HUMAN antibody
    • EP300 interacting inhibitor of differentiation 1 antibody
    • EP300-interacting inhibitor of differentiation 1 antibody
    • IRO45620 antibody
    • MGC138883 antibody
    • MGC138884 antibody
    • NB4 apoptosis related protein antibody
    • PNAS 22 antibody
    • PNAS22 antibody
    • PTD014 antibody
    • Rb and p300 binding protein EID 1 antibody
    • Rb and p300 binding protein EID1 antibody
    • RBP21 antibody
    • Retinoblastoma protein associated protein antibody
    see all

Images

  • Immunofluorescent analysis of PFA/Triton X-100 fixed U2OS cells labeling EID1 with ab188024 at 4µg/ml (green).

  • Immunohistochemical analysis of paraffin embedded Human testis tissue labeling EID1 with  ab188024 at 1/200 dilution.

References

ab188024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up