Overview

  • Product name
  • Description
    Rabbit polyclonal to EID2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Guinea pig, Cow, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 155-204 (

    QFLRHYLENYPIAPGRIQELEERRRRFVEACRAREAAFDIEYLRNPQRVD

    ) of Mouse EID2 (NM_198425).

  • Positive control
    • Mouse kidney lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab125373 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Interacts with EP300 and acts as a repressor of MYOD-dependent transcription and muscle differentiation. Inhibits EP300 histone acetyltransferase activity. Acts as a repressor of TGFB/SMAD transcriptional responses. May act as a repressor of the TGFB/SMAD3-dependent signaling by selectively blocking formation of TGFB-induced SMAD3-SMAD4 complex.
  • Tissue specificity
    Most abundantly expressed in placenta. Highly expressed in liver, brain, heart, skeletal muscle, and kidney.
  • Domain
    The N-terminal portion of EID2 is required for nuclear localization.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • CREBBP/EP300 inhibitor 2 antibody
    • CREBBP/EP300 inhibitory protein 2 antibody
    • CRI2 antibody
    • E1A like inhibitor of differentiation 2 antibody
    • EID-1-like inhibitor of differentiation 2 antibody
    • EID-2 antibody
    • EID2 antibody
    • EID2_HUMAN antibody
    • EP300-interacting inhibitor of differentiation 2 antibody
    see all

Images

  • Anti-EID2 antibody (ab125373) at 1 µg/ml + Mouse kidney lysate at 10 µg

    Predicted band size : 26 kDa

References

ab125373 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab125373.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up