Overview

  • Product nameAnti-EID2 antibody
    See all EID2 primary antibodies
  • Description
    Rabbit polyclonal to EID2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Guinea pig, Cow, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 155-204 (

    QFLRHYLENYPIAPGRIQELEERRRRFVEACRAREAAFDIEYLRNPQRVD

    ) of Mouse EID2 (NM_198425).

  • Positive control
    • Mouse kidney lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab125373 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionInteracts with EP300 and acts as a repressor of MYOD-dependent transcription and muscle differentiation. Inhibits EP300 histone acetyltransferase activity. Acts as a repressor of TGFB/SMAD transcriptional responses. May act as a repressor of the TGFB/SMAD3-dependent signaling by selectively blocking formation of TGFB-induced SMAD3-SMAD4 complex.
  • Tissue specificityMost abundantly expressed in placenta. Highly expressed in liver, brain, heart, skeletal muscle, and kidney.
  • DomainThe N-terminal portion of EID2 is required for nuclear localization.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • CREBBP/EP300 inhibitor 2 antibody
    • CREBBP/EP300 inhibitory protein 2 antibody
    • CRI2 antibody
    • E1A like inhibitor of differentiation 2 antibody
    • EID-1-like inhibitor of differentiation 2 antibody
    • EID-2 antibody
    • EID2 antibody
    • EID2_HUMAN antibody
    • EP300-interacting inhibitor of differentiation 2 antibody
    see all

Anti-EID2 antibody images

  • Anti-EID2 antibody (ab125373) at 1 µg/ml + Mouse kidney lysate at 10 µg

    Predicted band size : 26 kDa

References for Anti-EID2 antibody (ab125373)

ab125373 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125373.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"