Overview

  • Product name
  • Description
    Mouse polyclonal to eIF4A2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human eIF4A2 aa 1-100. (NP_001958).
    Sequence:

    MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYA YGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFK


    Database link: Q14240

  • Positive control
    • Jurkat cell lysate; Recombinant Human eIF4A2 protein (immunogen).

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituent: 50% Glycerol
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194471 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 46 kDa.

Target

Images

  • Anti-eIF4A2 antibody (ab194471) at 1/500 dilution + Jurkat cell lysate at 50 µg
    Developed using the ECL technique

    Predicted band size : 46 kDa
  • Anti-eIF4A2 antibody (ab194471) at 1/1000 dilution + Recombinant Human eIF4A2 protein (immunogen) at 0.2 µg
    Developed using the ECL technique

    Predicted band size : 46 kDa

    Predicted MWt of immunogen: 37.11 kDa.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

Application
Immunoprecipitation
Sample
Mouse Cell lysate - whole cell (mouse ESCs)
Total protein in input
20 µg
Immuno-precipitation step
Protein G
Specification
mouse ESCs
Username

Abcam user community

Verified customer

Submitted Jan 30 2017

Application
Western blot
Sample
Mouse Cell lysate - whole cell (Mouse embryonic stem cells)
Gel Running Conditions
Reduced Denaturing (12%)
Loading amount
30 µg
Specification
Mouse embryonic stem cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C
Username

Abcam user community

Verified customer

Submitted Jan 10 2017

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (Mouse embryonic stem cell line)
Permeabilization
Yes - 0.25% TritonX-100 solution
Specification
Mouse embryonic stem cell line
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 10% · Temperature: 37°C
Fixative
Paraformaldehyde
Username

Abcam user community

Verified customer

Submitted Jan 10 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up