Overview

  • Product nameAnti-Elongin A antibody
    See all Elongin A primary antibodies
  • Description
    Mouse polyclonal to Elongin A
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Saccharomyces cerevisiae
  • Immunogen

    Fusion protein:

    VKDIRNNKYRIPYRMLYSKYQQEVEKKQEESAERLRLEMQKLQQEREKKQ TIVVDHTVYFKKRNTKKTTRLHNEPHSQLYMKSLKDHESRLKHFKDGGFN

    , corresponding to amino acids 115/214 of S. cerevisiae Elongin A

  • General notesProduced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferConstituents: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notesThis antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab22093 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 44 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • FunctionSIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).
  • Sequence similaritiesContains 1 F-box domain.
    Contains 1 TFIIS N-terminal domain.
  • DomainThe elongin BC complex binding domain is also known as BC-box with the consensus [APST]-L-x(3)-C-x(3)-[AILV].
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
    • Alternative names
      • Ela1 antibody
      • Elo A antibody
      • EloA antibody
      • ELOA1_HUMAN antibody
      • Elongin 110 kDa subunit antibody
      • Elongin-A antibody
      • ElonginA antibody
      • RNA polymerase II transcription factor SIII subunit A1 antibody
      • SIII antibody
      • SIII p110 antibody
      • TCEB 3 antibody
      • Tceb3 antibody
      • TCEB3A antibody
      • Transcription elongation factor B (SIII) polypeptide 3 (110kD) antibody
      • Transcription elongation factor B (SIII) polypeptide 3 antibody
      • Transcription elongation factor B alpha subunit antibody
      • Transcription elongation factor B polypeptide 3 antibody
      see all

    References for Anti-Elongin A antibody (ab22093)

    ab22093 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab22093.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"