Overview

  • Product name
  • Description
    Rabbit polyclonal to Elp4
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Elp4 aa 286-368.
    Sequence:

    YVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSER ETNPLYKDYHGLIHIRQIPRLNNLICDESDVKD


    Database link: Q96EB1

  • Positive control
    • RT-4 cell line lysate; Human kidney tissue; A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab187746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 46 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the ELP4 family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • C11orf19 antibody
    • dJ68P15A.1 antibody
    • elongation protein 4 homolog (S. cerevisiae) antibody
    • Elongation protein 4 homolog antibody
    • Elongator complex protein 4 antibody
    • ELP4 antibody
    • ELP4_HUMAN antibody
    • FLJ20498 antibody
    • hELP4 antibody
    • PAX6 neighbor gene protein antibody
    • PAX6NEB antibody
    • PAXNEB antibody
    see all

Images

  • Anti-Elp4 antibody (ab187746) at 1/100 dilution + RT-4 cell line lysate

    Predicted band size : 46 kDa
  • Immunofluorescent analysis of PFA/Triton X-100 treated A431 cells labeling Elp4 with ab187746 at 4 µg/ml.

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling Elp4 with ab187746 at 1/50 dilution.

References

ab187746 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187746.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up