
  • Product name
  • Description
    Rabbit polyclonal to EME1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 504-553 (YPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR I) of Human EME1 (NP_689676).

  • Positive control
    • HT1080 cell lysate



Our Abpromise guarantee covers the use of ab89969 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 63 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. May be required in mitosis for the processing of stalled or collapsed replication forks.
  • Sequence similarities
    Belongs to the EME1/MMS4 family.
  • Cellular localization
    Nucleus > nucleolus. Recruited to regions of DNA damage in S-phase cells.
  • Information by UniProt
  • Database links
  • Alternative names
    • 6820428D13 antibody
    • Crossover junction endonuclease EME1 antibody
    • EC 3.1.22.- antibody
    • EME1 antibody
    • Eme1 essential meiotic endonuclease 1 homolog 1 (S. pombe) antibody
    • EME1, S. pombe, homolog of, 1 antibody
    • EME1_HUMAN antibody
    • essential meiotic endonuclease 1 homolog 1 (S pombe) antibody
    • Essential Meiotic Endonuclease 1 Homolog 1 antibody
    • essential meiotic endonuclease 1 homolog 2 antibody
    • Essential meiotic endonuclease 1, S. pombe, homolog of, 1 antibody
    • FLJ31364 antibody
    • hMMS4 antibody
    • homolog of yeast EME1 endonuclease antibody
    • MGC106543 antibody
    • MMS4 antibody
    • MMS4 homolog antibody
    • MMS4L antibody
    see all

Anti-EME1 antibody images

  • Anti-EME1 antibody (ab89969) at 1 µg/ml + HT1080 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 63 kDa
    Observed band size : 63 kDa
    Additional bands at : 47 kDa. We are unsure as to the identity of these extra bands.

References for Anti-EME1 antibody (ab89969)

This product has been referenced in:
  • Weinandy A  et al. Cetuximab induces eme1-mediated DNA repair: a novel mechanism for cetuximab resistance. Neoplasia 16:207-20, 220.e1-4 (2014). Read more (PubMed: 24731284) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab89969.
Please use the links above to contact us or submit feedback about this product.


Sign up