
  • Product name
  • Description
    Rabbit polyclonal to EME1
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 504-553 (YPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR I) of Human EME1 (NP_689676).

  • Positive control
    • HT1080 cell lysate



Our Abpromise guarantee covers the use of ab89969 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 63 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. May be required in mitosis for the processing of stalled or collapsed replication forks.
  • Sequence similarities
    Belongs to the EME1/MMS4 family.
  • Cellular localization
    Nucleus > nucleolus. Recruited to regions of DNA damage in S-phase cells.
  • Information by UniProt
  • Database links
  • Alternative names
    • 6820428D13 antibody
    • Crossover junction endonuclease EME1 antibody
    • EC 3.1.22.- antibody
    • EME1 antibody
    • Eme1 essential meiotic endonuclease 1 homolog 1 (S. pombe) antibody
    • EME1, S. pombe, homolog of, 1 antibody
    • EME1_HUMAN antibody
    • essential meiotic endonuclease 1 homolog 1 (S pombe) antibody
    • Essential Meiotic Endonuclease 1 Homolog 1 antibody
    • essential meiotic endonuclease 1 homolog 2 antibody
    • Essential meiotic endonuclease 1, S. pombe, homolog of, 1 antibody
    • FLJ31364 antibody
    • hMMS4 antibody
    • homolog of yeast EME1 endonuclease antibody
    • MGC106543 antibody
    • MMS4 antibody
    • MMS4 homolog antibody
    • MMS4L antibody
    see all


  • Anti-EME1 antibody (ab89969) at 1 µg/ml + HT1080 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 63 kDa
    Observed band size: 63 kDa
    Additional bands at: 47 kDa. We are unsure as to the identity of these extra bands.

    Gel concentration: 12%


This product has been referenced in:
  • Weinandy A  et al. Cetuximab induces eme1-mediated DNA repair: a novel mechanism for cetuximab resistance. Neoplasia 16:207-20, 220.e1-4 (2014). Read more (PubMed: 24731284) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab89969.
Please use the links above to contact us or submit feedback about this product.


Sign up