Overview

  • Product name
  • Description
    Mouse polyclonal to EMX2
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human EMX2 aa 1-252. (NP_004089.1)
    Sequence:

    MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNG FHSAAAAAAGRGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLP SSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNAL ARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKV WFQNRRTKFKRQKLEEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTS DD


    Database link: Q04743

  • Positive control
    • EMX2 transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab171818 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa.

Target

  • Function
    Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system.
  • Tissue specificity
    Cerebral cortex.
  • Involvement in disease
    Defects in EMX2 are the cause of schizencephaly (SCHZC) [MIM:269160]. Schizencephaly is an extremely rare human congenital disorder characterized by a full-thickness cleft within the cerebral hemispheres. These clefts are lined with gray matter and most commonly involve the parasylvian regions. Large portions of the cerebral hemispheres may be absent and replaced by cerebro-spinal fluid.
  • Sequence similarities
    Belongs to the EMX homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Empty spiracles homeobox 2 antibody
    • Empty spiracles homolog 2 (Drosophila) antibody
    • Empty spiracles homolog 2 antibody
    • Empty spiracles like protein 2 antibody
    • Empty spiracles-like protein 2 antibody
    • EMX 2 antibody
    • EMX2 antibody
    • EMX2_HUMAN antibody
    • Homeobox protein EMX 2 antibody
    • Homeobox protein EMX2 antibody
    see all

Images

  • All lanes : Anti-EMX2 antibody (ab171818) at 1 µg/ml

    Lane 1 : EMX2 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 28 kDa

References

ab171818 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171818.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up