Overview

  • Product name
  • Description
    Rabbit polyclonal to Endoglycan
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Macaque monkey, Rhesus monkey, Orangutan
  • Immunogen

    Synthetic peptide within Human Endoglycan aa 300-350. The exact sequence is proprietary.
    Sequence:

    HEEVPALPSFPQTTAPSGAEHPDEDPLGSRTSASSPLAPGDMELTPSSAT L


    Database link: Q9NZ53

  • Positive control
    • HeLa and 293T whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2500 - 1/5000. Predicted molecular weight: 65 kDa.

Target

Images

  • Immunoprecipitation of HeLa whole cell lysate using ab191173 (lane 1) at 6 µg per reaction (0.5 or 1 mg/IP; 20% of IP loaded/lane). Immunoblot analysis of  Endoglycan utilised ab191173 at 1µg/ml. The lysate in lane 2 is precipitated with an IgG control antibody. Detection utilised chemiluminescence with an exposure time of 30seconds.

  • All lanes : Anti-Endoglycan antibody (ab191173) at 1 µg/ml

    Lane 1 : HeLa whole cell lysate prepared using RIPA lysis buffer
    Lane 2 : 293T whole cell lysate prepared using RIPA lysis buffer
    Lane 3 : Jurkat whole cell lysate prepared using RIPA lysis buffer

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 65 kDa


    Exposure time: 30 seconds

References

ab191173 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up