Overview

  • Product nameAnti-Endothelin A Receptor antibody
    See all Endothelin A Receptor primary antibodies
  • Description
    Rabbit polyclonal to Endothelin A Receptor
  • Tested applicationsSuitable for: WB, ELISA, ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Human, African Green Monkey
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human Endothelin A Receptor aa 378-427 (C terminal). The exact sequence is proprietary. (NP_001948.1).
    Sequence:

    NCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN


    Database link: P25101
    (Peptide available as ab154991)

  • Positive control
    • LOVO cells. Extracts from COS-7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab76259 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 49 kDa.
ELISA 1/5000.
ICC/IF 1/500 - 1/1000.
IHC-P Use a concentration of 4 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • FunctionReceptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
  • Tissue specificityIsoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and liver but no expression in umbilical vein endothelial cells. Within the placenta, isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in the villi and stem villi vessels.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily.
  • Cellular localizationCell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Ednra antibody
    • EDNRA_HUMAN antibody
    • Endothelin 1 receptor precursor antibody
    • Endothelin 1 specific receptor antibody
    • Endothelin A receptor antibody
    • Endothelin ET A receptor antibody
    • Endothelin receptor ET1 specific type antibody
    • Endothelin receptor subtype A antibody
    • Endothelin receptor type A antibody
    • Endothelin-1 receptor antibody
    • ET A antibody
    • ET-A antibody
    • ETA antibody
    • ETA R antibody
    • ETA-R antibody
    • ETAR antibody
    • ETRA antibody
    • hET AR antibody
    • hET-AR antibody
    see all

Anti-Endothelin A Receptor antibody images

  • All lanes : Anti-Endothelin A Receptor antibody (ab76259) at 1/500 dilution

    Lane 1 : Extracts from COS-7 cells
    Lane 2 : Extracts from COS-7 cells plus 5µg immunizing peptide

    Lysates/proteins at 5 µg per lane.


    Predicted band size : 49 kDa
    Observed band size : 49 kDa
  • Immunofluorescence analysis of LOVO cells using ab76259 at a 1/500 dilution.
    Left image un-treated.
    Right image treated with immunizing peptide.
  • ab76259 (4µg/ml) staining Endothelin A receptor in human cerebellum using an automated system (DAKO Autostainer Plus). Using this protocol there is strong staining of the endothelium.
    Sections were rehydrated and antigen retrieved with the Dako 3 in 1 AR buffer EDTA pH 9.0 in a DAKO PT link. Slides were peroxidase blocked in 3% H2O2 in methanol for 10 mins. They were then blocked with Dako Protein block for 10 minutes (containing casein 0.25% in PBS) then incubated with primary antibody for 20 min and detected with Dako envision flex amplification kit for 30 minutes. Colorimetric detection was completed with Diaminobenzidine for 5 minutes. Slides were counterstained with Haematoxylin and coverslipped under DePeX. Please note that, for manual staining, optimization of primary antibody concentration and incubation time is recommended. Signal amplification may be required.

References for Anti-Endothelin A Receptor antibody (ab76259)

This product has been referenced in:
  • Lupp A  et al. Reassessment of endothelin receptor A expression in normal and neoplastic human tissues using the novel rabbit monoclonal antibody UMB-8. Peptides 66:19-25 (2015). IHC-P ; Human . Read more (PubMed: 25708416) »
  • Irani S  et al. Expression profile of endothelin 1 and its receptor endothelin receptor A in papillary thyroid carcinoma and their correlations with clinicopathologic characteristics. Ann Diagn Pathol 18:43-8 (2014). IHC-P ; Human . Read more (PubMed: 24332749) »

See all 3 Publications for this product

Product Wall

.

The immunizing peptide of ab76259 is now available as Endothelin A Receptor peptide (ab154991)-

http://www.abcam.com/endothelin-a-receptor-peptide-ab154991.html

Although we have not yet tested ab76259 with mouse tissues ...

Read More

Thank you for your message and for kindly providing the requested details. I am pleased to provide the following information: Endothelin -1 antibody ab2786 According to the image on the datasheet, this antibody has been successfully used in  hu...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"