Overview

  • Product name
    Anti-ENO1 antibody (FITC)
    See all ENO1 primary antibodies
  • Description
    Rabbit polyclonal to ENO1 (FITC)
  • Host species
    Rabbit
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Chicken, Cow, Human, Xenopus laevis, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Mouse ENO1 aa 2-434.
    Sequence:

    SILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRD NDKTRFMGKGVSQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTE NKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNPEVILPVPAFN VINGGSHAGNKLAMQEFMILPVGASSFREAMRIGAEVYHNLKNVIKEKYG KDATNVGDEGGFAPNILENKEALELLKTAIAKAGYTDQVVIGMDVAASEF YRSGKYDLDFKSPDDPSRYITPDQLADLYKSFVQNYPVVSIEDPFDQDDW GAWQKFTASAGIQVVGDDLTVTNPKRIAKAASEKSCNCLLLKVNQIGSVT ESLQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRS ERLAKYNQILRIEEELGSKAKFAGRSFRNPLAK


    Database link: P17182

Applications

Our Abpromise guarantee covers the use of ab193147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 47 kDa.

Target

  • Function
    Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production.
    MBP1 binds to the myc promoter and acts as a transcriptional repressor. May be a tumor suppressor.
  • Tissue specificity
    The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
  • Pathway
    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 4/5.
  • Sequence similarities
    Belongs to the enolase family.
  • Developmental stage
    During ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells.
  • Post-translational
    modifications
    ISGylated.
  • Cellular localization
    Nucleus and Cytoplasm. Cell membrane. Cytoplasm > myofibril > sarcomere > M line. Can translocate to the plasma membrane in either the homodimeric (alpha/alpha) or heterodimeric (alpha/gamma) form. ENO1 is localized to the M line.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2 phospho D glycerate hydro lyase antibody
    • 2-phospho-D-glycerate hydro-lyase antibody
    • Alpha enolase antibody
    • Alpha enolase like 1 antibody
    • Alpha-enolase antibody
    • C myc promoter binding protein antibody
    • C-myc promoter-binding protein antibody
    • EC 4.2.1.11 antibody
    • eno1 antibody
    • ENO1L1 antibody
    • ENOA_HUMAN antibody
    • Enolase 1 (alpha) antibody
    • Enolase 1 (alpha) like 1 antibody
    • Enolase 1 antibody
    • Enolase alpha antibody
    • MBP 1 antibody
    • MBP-1 antibody
    • MBP1 antibody
    • MBPB1 antibody
    • MPB 1 antibody
    • MPB-1 antibody
    • MPB1 antibody
    • MYC promoter binding protein 1 antibody
    • NNE antibody
    • Non neural enolase antibody
    • Non-neural enolase antibody
    • Phosphopyruvate hydratase antibody
    • Plasminogen binding protein antibody
    • Plasminogen-binding protein antibody
    • PPH antibody
    • Tau crystallin antibody
    see all

References

ab193147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up