Overview

  • Product nameAnti-ENPP1 antibody
    See all ENPP1 primary antibodies
  • Description
    Mouse polyclonal to ENPP1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Fusion protein:

    LIPTHFFIVLTSCKDTSQTPLHCENLDTLAFILPHRTDNSESCVHGKHDS SWVEELLMLHRARITDVEHITGLSFYQQRKEPVSDILKLKTHLPTFSQED

    , corresponding to amino acids 774-873 of Human ENPP1.

  • General notesProduced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferConstituents: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notesThis antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab21769 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 105 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • FunctionInvolved primarily in ATP hydrolysis at the plasma membrane. Plays a role in regulating pyrophosphate levels, and functions in bone mineralization and soft tissue calcification. In vitro, has a broad specificity, hydrolyzing other nucleoside 5' triphosphates such as GTP, CTP, TTP and UTP to their corresponding monophosphates with release of pyrophosphate and diadenosine polyphosphates, and also 3',5'-cAMP to AMP. May also be involved in the regulation of the availability of nucleotide sugars in the endoplasmic reticulum and Golgi, and the regulation of purinergic signaling. Appears to modulate insulin sensitivity.
  • Tissue specificityExpressed in plasma cells and also in a number of non-lymphoid tissues, including the distal convoluted tubule of the kidney, chondrocytes and epididymis.
  • Involvement in diseaseDefects in ENPP1 are a cause of increased susceptibility for ossification of the posterior longitudinal ligament of the spine (OPLL) [MIM:602475]. OPLL is a common form of human myelopathy with a prevalence of as much as 4% in a variety of ethnic groups.
    Defects in ENPP1 are the cause of arterial calcification of infancy, generalized, type 1 (GACI1) [MIM:208000]. A severe autosomal recessive disorder characterized by calcification of the internal elastic lamina of muscular arteries and stenosis due to myointimal proliferation. The disorder is often fatal within the first 6 months of life because of myocardial ischemia resulting in refractory heart failure.
    Defects in ENPP1 are associated with obesity, glucose intolerance, and type II diabetes non-insulin dependent (NIDDM) [MIM:125853].
    Defects in ENPP1 are the cause of rickets hypophosphatemic autosomal recessive type 2 (ARHR2) [MIM:613312]. ARHR2 is a hereditary form of hypophosphatemic rickets, a disorder of proximal renal tubule function that causes phosphate loss, hypophosphatemia and skeletal deformities, including rickets and osteomalacia unresponsive to vitamin D. Symptoms are bone pain, fractures and growth abnormalities.
  • Sequence similaritiesBelongs to the nucleotide pyrophosphatase/phosphodiesterase family.
    Contains 2 SMB (somatomedin-B) domains.
  • DomainThe di-leucine motif is required for basolateral targeting in epithelial cells, and for targeting to matrix vesicles derived from mineralizing cells.
  • Post-translational
    modifications
    Autophosphorylated as part of the catalytic cycle of phosphodiesterase/pyrophosphatase activity.
    N-glycosylated.
    It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both.
  • Cellular localizationMembrane. Basolateral cell membrane. Targeted to the basolateral membrane in polarized epithelial cells and in hepatocytes, and to matrix vesicles in osteoblasts. In bile duct cells and cancer cells, located to the apical cytoplasmic side.
  • Information by UniProt
  • Database links
  • Alternative names
    • Alkaline phosphodiesterase 1 antibody
    • ARHR2 antibody
    • E-NPP 1 antibody
    • Ectonucleotide pyrophosphatase/phosphodiesterase 1 antibody
    • Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 antibody
    • ENPP1 antibody
    • ENPP1_HUMAN antibody
    • Ly 41 antigen antibody
    • M6S1 antibody
    • Membrane component chromosome 6 surface marker 1 antibody
    • NPP1 antibody
    • NPPase antibody
    • NPPS antibody
    • Nucleotide pyrophosphatase antibody
    • PC-1 antibody
    • PCA1 antibody
    • PDNP1 antibody
    • Phosphodiesterase I/nucleotide pyrophosphatase 1 antibody
    • Plasma cell membrane glycoprotein 1 antibody
    • Plasma-cell membrane glycoprotein PC-1 antibody
    see all

Anti-ENPP1 antibody images

  • All lanes : Anti-ENPP1 antibody (ab21769) at 1/1000 dilution

    Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
    Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

    Secondary
    Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

    Performed under reducing conditions.

    Predicted band size : 105 kDa

References for Anti-ENPP1 antibody (ab21769)

ab21769 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab21769.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"